KEGG   Pseudomonas stutzeri CCUG 29243: A458_10190Help
Entry
A458_10190        CDS       T02168                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00040  Pentose and glucuronate interconversions
psc00052  Galactose metabolism
psc00500  Starch and sucrose metabolism
psc00520  Amino sugar and nucleotide sugar metabolism
psc01100  Metabolic pathways
psc01130  Biosynthesis of antibiotics
Module
psc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A458_10190
   00052 Galactose metabolism
    A458_10190
   00500 Starch and sucrose metabolism
    A458_10190
   00520 Amino sugar and nucleotide sugar metabolism
    A458_10190
Enzymes [BR:psc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A458_10190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFM33275
UniProt: I4CT68
Position
complement(2219281..2220120)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLNQIAIVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILSGRPLIG
DEPFAVVLADDLCINLNGDPVLAQMVKLYNQFRCSIVAIQEVPPEETSKYGVIAGEMIRD
DIYRVSHMVEKPKPEDAPSNMAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMRQAQD
GCVLAYKFKGQRFDCGSAEGYIAATNFCYEHFYLTGKAF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcctttttcccgctgccggatatggcacccgttttcttcctgcaacc
aaagccatgcccaaggaaatgctgccggtggtgaacaagcccctgattcagtacggggtt
gaagaggcgctggcggcggggctgaaccagatcgcgatcgtcaccgggcgtggcaagcgc
tcgctggaagaccatttcgacatcagctacgagctggagcaccagatccgcaacaccgac
aaggaaaagtacctggtcggtattcgccgcctgatcgacgaatgcagcttctcctacacc
cgccaggtggagatgaagggcttggggcatgcgattctcagcggccgcccgctgatcggc
gatgagccgttcgccgtggtcctggctgacgacctttgcatcaacctcaatggcgatccg
gtcctggcgcagatggtcaagctctacaaccagttccgctgctcgatcgttgccattcag
gaagtgccgccggaagagaccagcaagtacggtgtgatcgccggcgagatgatccgcgac
gatatctaccgcgtcagccacatggtcgagaagcccaagccggaagatgcgccgtccaac
atggcgatcatcggtcgctacatcctgactccggacatcttcgatctgatcgagcagacc
gagccgggcaagggcggtgagattcagatcaccgacgcgctgatgcgccaggctcaggat
ggttgcgtgctggcatacaagttcaagggccagcgcttcgactgcggtagcgctgagggc
tacatcgcggcgaccaacttctgctacgagcacttctacctgaccggcaaggcgttctga

DBGET integrated database retrieval system