KEGG   Pseudomonas stutzeri CCUG 29243: A458_10705Help
Entry
A458_10705        CDS       T02168                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    A458_10705
Enzymes [BR:psc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     A458_10705
   3.1.2  Thioester hydrolases
    3.1.2.-  
     A458_10705
Lipid biosynthesis proteins [BR:psc01004]
 Fatty acid synthase
  Component type
   A458_10705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2333925..2334530)
Genome map
AA seq 201 aa AA seqDB search
MRKWLKCGALALLCWTQGALAGTVLVVGDSISAAFGLETSQGWVHLLQERLVGADDSWRV
VNASISGDTTSGGLARLGPLLEEYAPEVVILELGGNDGLRGQSPAQLKQNLAEMIDRSRE
AGAEVLLLGMRMPPNLGQRYTRAFADAFDSLAAEKPVAYVPFLLEGVGGVAGMMQADGIH
PTAEAQTQLLDTVWPVLEPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagtggctgaaatgcggggctctggcgctgctgtgctggacgcagggagccctg
gccggaaccgtactggtggtcggcgatagtatcagcgcggctttcgggctggaaaccagc
caggggtgggtgcatctgctgcaggaacgcctggtcggggcggatgactcgtggcgcgtg
gtgaacgcttcgatcagtggcgacaccacgtctggcgggctcgcgcggcttggtccgttg
ctcgaggagtatgctcccgaggtggtgattctcgagctgggaggcaacgacggtctgcgt
gggcagtcgccagcgcaattgaaacagaatcttgccgagatgatcgatcgcagccgcgag
gcgggtgcagaggtcctgttgcttggaatgcgtatgccgcccaatctcgggcagcgttac
acccgcgcgttcgctgacgctttcgactctctggcagcggagaaaccggtggcttatgtg
ccgtttctgctggagggggttggtggcgtcgcggggatgatgcaggccgatggcattcac
cccaccgcagaggcccagacccagctgctggataccgtctggccggtgctcgagcccttg
ctttga

DBGET integrated database retrieval system