KEGG   Pseudomonas stutzeri CCUG 29243: A458_10940Help
Entry
A458_10940        CDS       T02168                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A458_10940
Enzymes [BR:psc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     A458_10940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2386595..2387152
Genome map
AA seq 185 aa AA seqDB search
MNDLPGHYREILSGVGENPEREGLRDTPQRAAKAMQYLCGGYNRSLEEIVNGALFASDND
EMVIVKDIELYSLCEHHMLPFIGKAHVAYIPTGRVLGLSKIARIVDMFARRLQIQENLTR
QIAEAIQEVTGAAGVAVVIEAKHMCMMMRGVEKQNSVMNTSVMLGAFRSSCNTRMEFLQL
IGRGQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctgcctggtcattaccgcgaaatactctccggggtgggtgaaaacccggag
cgtgaaggtctgcgcgacacgccgcaacgcgcggcgaaggcgatgcaatacctgtgcggc
ggttacaaccgcagcctggaagagatcgtcaacggcgcgctgttcgcctcggacaatgac
gagatggtcatcgtcaaggacatcgagctgtactccctgtgcgagcaccacatgctgccc
ttcatcggcaaggctcatgtggcgtacatccccaccgggcgcgtgctgggcttgtcgaag
attgcgcgaatcgtcgacatgttcgcccgccgcctgcagatccaggaaaatctgacccgc
cagatcgccgaagccattcaggaagtcaccggcgccgctggtgttgcggtggtcatcgaa
gccaaacacatgtgcatgatgatgcgcggcgtggaaaagcagaactcggtgatgaacacc
tcggtgatgctcggggcgttccgcagctcctgcaacacacggatggaatttctacagctg
atcgggaggggccagtaa

DBGET integrated database retrieval system