KEGG   Pseudomonas stutzeri CCUG 29243: A458_10940Help
Entry
A458_10940        CDS       T02168                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2386595..2387152
Genome map
AA seq 185 aa AA seqDB search
MNDLPGHYREILSGVGENPEREGLRDTPQRAAKAMQYLCGGYNRSLEEIVNGALFASDND
EMVIVKDIELYSLCEHHMLPFIGKAHVAYIPTGRVLGLSKIARIVDMFARRLQIQENLTR
QIAEAIQEVTGAAGVAVVIEAKHMCMMMRGVEKQNSVMNTSVMLGAFRSSCNTRMEFLQL
IGRGQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctgcctggtcattaccgcgaaatactctccggggtgggtgaaaacccggag
cgtgaaggtctgcgcgacacgccgcaacgcgcggcgaaggcgatgcaatacctgtgcggc
ggttacaaccgcagcctggaagagatcgtcaacggcgcgctgttcgcctcggacaatgac
gagatggtcatcgtcaaggacatcgagctgtactccctgtgcgagcaccacatgctgccc
ttcatcggcaaggctcatgtggcgtacatccccaccgggcgcgtgctgggcttgtcgaag
attgcgcgaatcgtcgacatgttcgcccgccgcctgcagatccaggaaaatctgacccgc
cagatcgccgaagccattcaggaagtcaccggcgccgctggtgttgcggtggtcatcgaa
gccaaacacatgtgcatgatgatgcgcggcgtggaaaagcagaactcggtgatgaacacc
tcggtgatgctcggggcgttccgcagctcctgcaacacacggatggaatttctacagctg
atcgggaggggccagtaa

DBGET integrated database retrieval system