KEGG   Pseudomonas stutzeri CCUG 29243: A458_11455Help
Entry
A458_11455        CDS       T02168                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00020  Citrate cycle (TCA cycle)
psc00640  Propanoate metabolism
psc00660  C5-Branched dibasic acid metabolism
psc01100  Metabolic pathways
psc01110  Biosynthesis of secondary metabolites
psc01120  Microbial metabolism in diverse environments
psc01130  Biosynthesis of antibiotics
psc01200  Carbon metabolism
Module
psc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A458_11455 (sucC)
   00640 Propanoate metabolism
    A458_11455 (sucC)
   00660 C5-Branched dibasic acid metabolism
    A458_11455 (sucC)
Enzymes [BR:psc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A458_11455 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AFM33526
UniProt: I4CTW9
Position
complement(2507583..2508749)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDSPKEAAEACDKIGGTQWVVKAQVHAGGRGKAGGV
KLVRSKDEARAFAQQWLDKRLVTYQTDANGQPVSKILVEACTDIDKELYLGAVVDRASRR
VVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPFQARELAFQLGLKGDQVKQFVHI
FVGLAQLFQDYDLALLEVNPLVIKKDGNLHCLDAKINIDSNAIYRQPKLRDMADPSQDDP
REAHAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGAPANFLDVGGGATEERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVREVGVKVPVVVRLEGNNADLGAKM
LSESGLNIIGASSLTDAAIQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtaccaaggtaaacaactgttcgctgaatacggtctgcccgtgtcc
aagggttacgcagtcgatagcccgaaggaagcagcggaagcctgcgacaagatcggcgga
acgcaatgggtggtcaaagcccaggtgcatgccggtggacgtggcaaggcaggtggcgta
aagctggttcgcagcaaggatgaagcacgggcgtttgcccagcagtggcttgacaagcgc
ctggtgacctatcagaccgacgccaatggtcagccagtcagcaagatccttgtcgaggct
tgcaccgatatcgacaaggaactctatctgggcgccgtggttgatcgcgccagtcgtcgg
gtcgtgttcatggcctccaccgaaggtggcgtggatatcgaaaaagtcgctcacgacacg
cctgagaaaatcctcaaggccaccatcgacccgctggtcggcgcgcagccgttccaggcg
cgcgagctggcattccagctgggcctgaagggcgatcaggtcaagcagttcgtccatatc
ttcgtcggccttgcccagttgttccaggactatgacctggccctgctcgaagtgaacccg
ctggtgatcaagaaggacggcaacctgcactgcctggatgccaagatcaacatcgacagc
aacgccatctatcgtcaaccgaaactgcgcgacatggccgatccgtctcaggacgatccg
cgcgaggcccatgcagccaagtgggagctcaattacgtagcgctcgacggcaacatcggc
tgcatggtcaatggtgcgggcctggcgatgggcaccatggatatcgtcaacctgcatggc
ggcgcgccggcgaacttcctcgacgtgggcggtggagccaccgaggaacgcgtgaccgaa
gcgttcaagatcattctctccgacagcaatgtcgcggccgttctggtgaacatcttcggc
ggcatcgtgcgatgcgacatgatcgccgaaggcatcatcggtgccgttcgcgaagtgggc
gtcaaggtgcccgtggtggttcgcctggaaggcaacaacgccgacttgggggccaagatg
ctgagtgaaagcggtctgaacatcatcggtgcgagcagcctgaccgatgcggccattcag
gttgtcaaagccgcggagggcaagtaa

DBGET integrated database retrieval system