KEGG   Pseudomonas stutzeri CCUG 29243: A458_11465Help
Entry
A458_11465        CDS       T02168                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A458_11465
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A458_11465
  Amino acid metabolism
   00310 Lysine degradation
    A458_11465
Enzymes [BR:psc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A458_11465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2510474..2511694)
Genome map
AA seq 406 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVMEVLAEADGVLTEIV
KNEGDTVLSGELLGKLEAGATAAAAPAPAAAPAQAAAPAAAATAGEEPILAPAARKMAEE
NGIDPNSIAGTGKDGRVTKEDVVAAVEAKKSAPAAAAKPAAPAASAPIFAEGDRVEKRVP
MTRLRAKVAERLVEAQSSMAMLTTFNEVNMKPIMELRSKYKDLFEKTHNGVRLGFMSFFV
KAAVEALKRQPGVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAEHMSLAEIEGGI
NNFGKKAKAGKLTIEEMTGGTFTISNGGVFGSLLSTPIVNPPQTAILGMHKIQERPMAVN
GQVVILPMMYLALSYDHRLIDGKEAVTFLVTMKDLLEDPARLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccctacattcccggaatcggttgccgacggcaccgttgcc
acctggcacaagcagccgggcgacgcggtcaagcgtgatgagctgatcgtcgacatcgaa
accgacaaggtggtgatggaagtgctcgccgaagctgacggcgtgctgaccgagatcgtc
aagaacgaaggcgacaccgtgctgagcggcgagctgctcggcaagctggaggctggtgct
actgccgccgccgcacctgcgccggctgctgccccggctcaagctgctgctccggctgct
gccgcaaccgcaggtgaagagccaatcctggctcctgctgcgcgcaagatggccgaagag
aacggcatcgatccgaacagcatcgccggtactggtaaagatggccgcgtgaccaaggaa
gacgtggttgccgccgttgaagctaagaaatccgctccggctgctgctgccaagccggct
gctccagctgcctccgctccgatctttgccgagggcgatcgtgtcgagaagcgcgtgccg
atgacccgcctgcgtgcgaaggtcgccgagcgtctggtcgaagcgcaatcctccatggcg
atgctgactacgttcaacgaagtcaacatgaagccgatcatggagctgcgttccaagtac
aaggatctgtttgagaagactcacaacggcgtgcgcctgggcttcatgtccttcttcgtc
aaggccgcggttgaagcactcaagcgccagccgggcgtcaacgcttccattgatggcaat
gacatcgtctaccacggttatcaggatatcggcgtcgccgtttccagcgaccgcggcctg
gtggttccggtcctgcgcaacgccgagcacatgagcctggccgagatcgaaggcggcatc
aataacttcggcaagaaggccaaggccggcaagctgaccatcgaagagatgactggcggc
accttcaccatctccaatggtggtgtgtttggctcgctgctgtcgacgccgatcgtcaac
ccacctcagaccgccatcctcggtatgcacaagatccaggaacgcccgatggccgttaac
ggtcaagtggtcatcctgccgatgatgtacctggccctgtcctatgaccatcgcttgatc
gacggcaaggaagcggtgaccttcctggttaccatgaaggacctgctggaagacccggcc
cgtctgctgctggatatctga

DBGET integrated database retrieval system