KEGG   Pseudomonas stutzeri CCUG 29243: A458_12065Help
Entry
A458_12065        CDS       T02168                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:psc00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:psc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2646686..2647894
Genome map
AA seq 402 aa AA seqDB search
MSSDPRFTAMPDANGHFGPYGGQLVPPHLKQAMDDINLAYEEIRQRDDFQQELAALFADY
VGRPSPIFHARRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKFMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMKILGCKLIAVTRGAATLKEAVD
SAFEEYLKDPHNYIYAIGSVVGPHPFPKMVRDFQSIIGTEAREQFLAKHGRLPDHVVACV
GGGSNAMGMFTAFLDDAAVELVGIEPAGESLDKPGRHSATLSKGKPGELHGMACYVLEDA
DGNPSAVHSIASGLDYPGVGPQHSYLKDIGRVNYQTATDQECLDAFMTLSRVEGIIPALE
SAHAVAWAIRSAPTLSKESHILVNLSGRGDKDADYVANLLGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgatcctcgcttcaccgccatgcccgacgccaacggacatttcggcccctat
ggcggccagctggtcccaccgcacctcaagcaagctatggacgacatcaacctggcgtac
gaggaaattcgccagcgcgatgacttccagcaggaactggcggcactgttcgctgactac
gtcggccgtccgagcccgatcttccatgctcggcggttgtccgagcagcttggtggcgcg
cagatctatctgaagcgcgaagacctgaaccacaccggcgcgcacaagatcaatcactgc
ctgggcgaggcgctgctggccaaattcatgggcaagaagaaggtgatcgcggagactggc
gcaggacagcacggggttgccctggctaccgcctgcgcgctggtcggcattccctgcgag
atccacatgggccaggtggacatcgagaaggaacacccgaacgtcaccaagatgaagatc
ctcggctgcaagctgatcgccgtcacccgcggcgccgcgacgctcaaggaggcggtagat
agcgctttcgaggagtacctgaaagatccgcacaactacatctacgccatcggctcggtg
gtcggtccgcatccgttcccgaagatggttcgcgacttccagtcgatcatcggcaccgag
gcccgtgagcagttcctcgccaaacatggccgcctgcccgaccacgtggttgcctgcgtc
gggggtggctcgaatgccatgggcatgttcaccgcctttctcgatgatgccgcggtcgag
ctggtcggtatcgagccagcgggtgaaagcctggacaagccaggccgccactcggccaca
ctgtccaaaggcaagccaggcgaactgcatggaatggcctgctacgtactggaggatgcc
gacggcaacccatcggcggtgcactcaatcgcctccggcctggactacccgggggtcggc
ccacagcacagctaccttaaagacatcggccgggtgaactaccagaccgcgaccgaccag
gaatgcctcgacgcctttatgaccctttcccgcgtcgaaggcatcatcccggccctggaa
agcgcccacgcagtggcctgggccatccgcagcgcaccgacgctgagcaaggaaagccat
atcctcgtcaatctatctggccgcggcgacaaggatgctgattacgtcgccaatctgctc
ggcctgtaa

DBGET integrated database retrieval system