KEGG   Pseudomonas stutzeri CCUG 29243: A458_12155Help
Entry
A458_12155        CDS       T02168                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00071  Fatty acid degradation
psc00280  Valine, leucine and isoleucine degradation
psc00281  Geraniol degradation
psc00310  Lysine degradation
psc00362  Benzoate degradation
psc00380  Tryptophan metabolism
psc00410  beta-Alanine metabolism
psc00640  Propanoate metabolism
psc00650  Butanoate metabolism
psc00903  Limonene and pinene degradation
psc00930  Caprolactam degradation
psc01040  Biosynthesis of unsaturated fatty acids
psc01100  Metabolic pathways
psc01110  Biosynthesis of secondary metabolites
psc01120  Microbial metabolism in diverse environments
psc01130  Biosynthesis of antibiotics
psc01200  Carbon metabolism
psc01212  Fatty acid metabolism
Module
psc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A458_12155 (fadB)
   00650 Butanoate metabolism
    A458_12155 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    A458_12155 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    A458_12155 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A458_12155 (fadB)
   00310 Lysine degradation
    A458_12155 (fadB)
   00380 Tryptophan metabolism
    A458_12155 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A458_12155 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A458_12155 (fadB)
   00281 Geraniol degradation
    A458_12155 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A458_12155 (fadB)
   00930 Caprolactam degradation
    A458_12155 (fadB)
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A458_12155 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A458_12155 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A458_12155 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     A458_12155 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFM33666
UniProt: I4CUA9
Position
complement(2663495..2665642)
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNDLRQAVDAIKADASVKGVIVTS
GKDVFIVGADITEFVDNFKMADEELVAGNLEANKIFSDFEDLGVPTVSAINGIALGGGFE
MCMAADYRVMSTAAKVGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDAL
KVHAVDAVVAPDKLQAAALDLVKRAISGELDYKAKRQPKLDKLKLNAIEQMMAFETSKAF
VAGQAGPNYPAPVEAIKTIQKAANFTRDKAIEVEAAGFVKLAKTSVAQSLVGLFLSDQEL
KKKAKAYDKQARDVKLAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEGIQMGLDEASKL
LGKRVEKGRLTADKMAQALNAIRPTMSYGDFGNVDIVVEAVVENPKVKHAVLAEVEEHVR
EDAIIASNTSTISINYLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTSEVAIATTVA
YAKKMGKSPVVVNDCPGFLVNRVLFPYFGGFARAIAHGVDFVRADKVMEKFGWPMGPAYL
MDVVGMDTGHHGRDVMAEGFPDRMKDDTRTAVDVMYEANRLGQKNGKGFYAYEMDKRGKP
KKVVDAEAYELLKPIVAETRELSDEDIINYMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVAMADKYADLGPLYHPTAKLREMAANGQRFYG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgagagcggcatcgtcgaattg
aatttcgacctcaagggtgagtccgtcaacaagttcaatcgcctcactctcaacgatctg
cgccaggccgtcgatgccatcaaggctgacgcgtcggtgaaaggcgtcatcgtaaccagc
ggcaaggacgtattcatcgtcggcgccgacatcaccgaattcgtcgacaacttcaagatg
gctgacgaggaactggtcgccggcaacctcgaagcgaacaagatcttcagcgatttcgaa
gacctgggcgtacccaccgtgtccgccatcaacggcatcgccctgggtggcggtttcgag
atgtgcatggccgccgactatcgcgtcatgtccaccgccgccaaggtcggtctgccggaa
gtgaagctgggcatctacccgggcttcggcggcaccgtacgcctgccgcgtctgatcggt
gtggataacgccgtcgagtggatcgcatccggcaaggaaaaccgcgccgaagacgcgctc
aaggttcatgcagtcgatgccgtggtcgccccggacaaactgcaggccgctgcactggat
ctggtcaagcgcgccatttccggcgagctggactacaaggccaagcgtcagccgaagctg
gacaagctcaagctcaacgccatcgagcagatgatggccttcgaaaccagcaaggcattc
gttgctggccaggccggcccgaactatccggccccggtcgaagccatcaagaccatccag
aaagccgccaacttcacccgtgacaaggccatcgaagtcgaggccgccggcttcgtcaaa
ctggccaagacctcggttgcacagagcttggtcggtctgttcctcagcgatcaggaactg
aagaagaaggccaaggcctacgacaagcaggcgcgtgacgtgaaactggctgccgtactc
ggcgccggcatcatgggtggcggcatcgcctaccagtcggctgtcaagggcacgccgatc
ctgatgaaggatatccgtgaagagggtatccagatgggtctggacgaggcctccaagctg
ctcggcaagcgtgtcgagaaaggccgtctgactgccgacaagatggctcaggcgctcaac
gcgatccgcccgaccatgtcctatggtgatttcggcaacgtcgacatcgtcgtcgaagcg
gtagtcgagaacccgaaggtcaagcacgccgtgctggccgaggtggaagagcacgttcgc
gaagacgcgatcatcgcctccaacacctcgacgatctccatcaactacctggcccaggcg
ctcaagcgtccggaaaacttctgcggcatgcacttcttcaacccggtacacatgatgccg
ctggtggaagtgatccgtggcgagaagaccagcgaagtggctattgctaccaccgtcgcc
tacgccaagaagatgggcaagagcccggtcgtggtcaacgattgcccgggcttcctggtc
aaccgcgtgctgttcccgtacttcggcggcttcgcccgcgccatcgcccacggtgtcgac
ttcgttcgcgctgataaggtgatggagaagttcggctggcccatgggcccggcttatctg
atggatgtcgtcggcatggacaccggccaccacggccgtgacgtgatggctgaaggcttc
ccggatcgcatgaaggacgacacccgcacggctgtcgacgtcatgtacgaggccaaccgt
cttggccagaagaacggcaagggcttctacgcctacgagatggacaagaggggcaagccg
aagaaggtcgtcgatgccgaggcctacgagctgctcaagccgatcgttgccgagactcgc
gagctgtccgacgaggacatcatcaactacatgatgatcccgctgtgcctggaaaccgtg
cgctgcctggaagacggcatcgtcgagaccgctgccgaagccgacatgggcctgatctat
ggcattggcttcccacccttccgtggtggtgcgctgcgctacatcgattcgatcggcgtc
gccgagttcgtcgcgatggccgacaagtacgccgacctgggcccgctgtaccacccgacc
gcgaagctgcgcgagatggctgccaacggccagcgcttctacggttaa

DBGET integrated database retrieval system