KEGG   Pseudomonas stutzeri CCUG 29243: A458_12365Help
Entry
A458_12365        CDS       T02168                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00790  Folate biosynthesis
psc01100  Metabolic pathways
Module
psc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A458_12365 (folE)
Enzymes [BR:psc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     A458_12365 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI MAPKK1_Int
Motif
Other DBs
NCBI-ProteinID: AFM33708
UniProt: I4CUF1
Position
2717211..2717756
Genome map
AA seq 181 aa AA seqDB search
MSLEQHYTAILGQLGEDVSREGLLDTPKRAAKAMQYLCKGYQQTLEEVTNGALFTSDNSE
MVLVKNIELYSLCEHHMLPFIGKAHVAYLPNGKVLGLSKVARIVDMYARRLQIQENLTRE
IAEAMQQVTGASGVAVVIEAQHMCMMMRGVEKQNSSMVTSVMLGQFRDNAATRSEFLGLV
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggaacaacactacaccgcgatcctcggccaactcggcgaggacgttagccgc
gaaggtctgctcgacacgcccaagcgcgccgccaaagccatgcagtacctgtgcaagggc
tatcagcaaaccctcgaggaagtcaccaacggcgcgctgttcacgtcagataacagcgag
atggtgctggtcaagaatatcgagctgtactcgctgtgcgagcatcacatgctgcctttc
atcggcaaggcacacgttgcgtatcttcccaatggcaaggtactcggcctgtcaaaggtc
gctcgtattgtggatatgtatgcgcgccgcctgcagattcaggaaaacctgacccgtgaa
atcgccgaggcgatgcagcaggttaccggcgcatcaggtgtggcggtggtcatcgaagcc
cagcacatgtgcatgatgatgcgcggcgtggagaagcagaactcgtccatggtcacatcg
gtgatgctgggtcagttccgcgataacgccgcgacccgtagcgagtttctcggcttggtg
aaatag

DBGET integrated database retrieval system