KEGG   Pseudomonas stutzeri CCUG 29243: A458_12775Help
Entry
A458_12775        CDS       T02168                                 

Definition
(GenBank) carbohydrate kinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00010  Glycolysis / Gluconeogenesis
psc00030  Pentose phosphate pathway
psc00051  Fructose and mannose metabolism
psc00052  Galactose metabolism
psc00680  Methane metabolism
psc01100  Metabolic pathways
psc01110  Biosynthesis of secondary metabolites
psc01120  Microbial metabolism in diverse environments
psc01130  Biosynthesis of antibiotics
psc01200  Carbon metabolism
psc01230  Biosynthesis of amino acids
Module
psc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A458_12775
   00030 Pentose phosphate pathway
    A458_12775
   00051 Fructose and mannose metabolism
    A458_12775
   00052 Galactose metabolism
    A458_12775
  Energy metabolism
   00680 Methane metabolism
    A458_12775
Enzymes [BR:psc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A458_12775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AFM33786
UniProt: I4CUM9
Position
complement(2806018..2806968)
Genome map
AA seq 316 aa AA seqDB search
MPLIATLTLNPAMDLSVSTARVISTEKLRCSLPRHDPGGGGINVARVVKTLGGRAIAIYP
AGGPFGDLLKRSLDELGLVHRPVSITGDTRESFTVDELGSGLQYRFVLPGPTLSAQELQR
CLDSLVALQPAPAYVVLSGSFPPGVDLGFYDELLALTRGIGARLVVDLSGEPLRHAARQG
GAYLMKPSLDELSSLVGYPISSEAEQAAALRRLIAQGCAEVVVLSLGAQGALYACGDELQ
RLPSADVPVVSAVGAGDSMLGAMVLALAEARSLQDAVCRGIAAGAATVMRPGTELCHRED
VQRLLQSVADAPIRSG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgattgcgaccctgaccctcaaccccgcgatggacctttccgtgagcaccgcc
cgggtgatcagtaccgaaaagctgcggtgttcgctgccgcgccacgacccgggtggcggc
gggatcaacgtggcgcgggtggtgaagacgctcgggggcagggcgatcgccatctatccg
gctggagggccctttggcgatctcctgaaacgttcgctggacgaactgggtctggtgcat
cgtccggtgtccattactggcgatacccgcgagagtttcactgtcgacgagctgggctca
ggcctgcagtaccgtttcgtgttgcccggtccgacgctatccgcgcaggaacttcagcgt
tgcctcgacagcctcgtagcgctgcagccagcgccggcctatgtggtgctgagcggcagc
tttccacctggcgtcgacctgggtttctacgacgagctgctggcattgacgcgcggtatc
ggtgcgcggctggtcgtcgatctgtccggcgagccattacgccacgccgcccggcagggc
ggtgcatacctgatgaagccgagcctcgacgagctgtccagccttgtgggctaccccatc
tccagcgaggccgaacaggcggcagcgctgcgccgcctgatcgctcagggctgcgccgaa
gtggtcgtgttgtcgctgggagcccagggtgcgctgtacgcctgtggcgatgagctgcag
cgcctgccgtcggcggatgtcccggtagtcagcgcggtgggtgcgggtgacagcatgctc
ggcgccatggtgctggcgctggccgaggcgcgctcgctacaggatgcggtgtgccggggc
attgccgcgggtgccgcgacggtgatgcgtccgggcaccgagctgtgtcatcgcgaggat
gtccagcggttgctgcaatctgtggcagacgcccctattcgatccggttga

DBGET integrated database retrieval system