KEGG   Pseudomonas stutzeri CCUG 29243: A458_12775Help
Entry
A458_12775        CDS       T02168                                 

Definition
carbohydrate kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A458_12775
   01230 Biosynthesis of amino acids
    A458_12775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A458_12775
   00030 Pentose phosphate pathway
    A458_12775
   00051 Fructose and mannose metabolism
    A458_12775
   00052 Galactose metabolism
    A458_12775
  Energy metabolism
   00680 Methane metabolism
    A458_12775
Enzymes [BR:psc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A458_12775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2806018..2806968)
Genome map
AA seq 316 aa AA seqDB search
MPLIATLTLNPAMDLSVSTARVISTEKLRCSLPRHDPGGGGINVARVVKTLGGRAIAIYP
AGGPFGDLLKRSLDELGLVHRPVSITGDTRESFTVDELGSGLQYRFVLPGPTLSAQELQR
CLDSLVALQPAPAYVVLSGSFPPGVDLGFYDELLALTRGIGARLVVDLSGEPLRHAARQG
GAYLMKPSLDELSSLVGYPISSEAEQAAALRRLIAQGCAEVVVLSLGAQGALYACGDELQ
RLPSADVPVVSAVGAGDSMLGAMVLALAEARSLQDAVCRGIAAGAATVMRPGTELCHRED
VQRLLQSVADAPIRSG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgattgcgaccctgaccctcaaccccgcgatggacctttccgtgagcaccgcc
cgggtgatcagtaccgaaaagctgcggtgttcgctgccgcgccacgacccgggtggcggc
gggatcaacgtggcgcgggtggtgaagacgctcgggggcagggcgatcgccatctatccg
gctggagggccctttggcgatctcctgaaacgttcgctggacgaactgggtctggtgcat
cgtccggtgtccattactggcgatacccgcgagagtttcactgtcgacgagctgggctca
ggcctgcagtaccgtttcgtgttgcccggtccgacgctatccgcgcaggaacttcagcgt
tgcctcgacagcctcgtagcgctgcagccagcgccggcctatgtggtgctgagcggcagc
tttccacctggcgtcgacctgggtttctacgacgagctgctggcattgacgcgcggtatc
ggtgcgcggctggtcgtcgatctgtccggcgagccattacgccacgccgcccggcagggc
ggtgcatacctgatgaagccgagcctcgacgagctgtccagccttgtgggctaccccatc
tccagcgaggccgaacaggcggcagcgctgcgccgcctgatcgctcagggctgcgccgaa
gtggtcgtgttgtcgctgggagcccagggtgcgctgtacgcctgtggcgatgagctgcag
cgcctgccgtcggcggatgtcccggtagtcagcgcggtgggtgcgggtgacagcatgctc
ggcgccatggtgctggcgctggccgaggcgcgctcgctacaggatgcggtgtgccggggc
attgccgcgggtgccgcgacggtgatgcgtccgggcaccgagctgtgtcatcgcgaggat
gtccagcggttgctgcaatctgtggcagacgcccctattcgatccggttga

DBGET integrated database retrieval system