KEGG   Pseudomonas stutzeri CCUG 29243: A458_13245Help
Entry
A458_13245        CDS       T02168                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A458_13245
Enzymes [BR:psc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     A458_13245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2905890..2906921
Genome map
AA seq 343 aa AA seqDB search
MALVATLSAVGASAADWPTSDKGLALLGVNISGAGFAPHVTPGKNGTNYFYPEKKHFKYY
ADQGIRLIRFPFIWERVQHSLDDGLNFDQIRLLKKTLDLAAMNGQKVILDMHNYGRYHGE
LIGSSKVPYDAYASVWRELAKRFKGHRGLLGYDIMNEPHGTVGLWPGAAQAAVDAIREVD
DQTLIFIEGERWSSAYHWPLVNANFLINDPADRIVYEAHLYFDQDFSGKYMAQTSRDIDP
MIGVERARPFIEWLKKHGQRGFLGEYGIPDDLPEAAVAMDNLLAYLNDNCVPSAYWAGGP
GWGTYKLAIEPRKGEDRPQMELMRKHLANDCTAIGPTPAHNAD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtggcactggtggccacgctgtccgcagtcggcgcgagcgccgccgattggccaaccagc
gacaagggcctcgccctgctcggggtcaatatctccggcgccggatttgccccacacgtg
actccgggcaagaacggcacgaactacttctatccggaaaaaaagcacttcaagtactac
gccgatcagggcatccgcctgatccgctttcccttcatctgggagcgggttcaacactcg
ctcgatgacggattgaacttcgaccagatccggttgttgaagaagaccctggatctggcc
gcgatgaatggccagaaggtcattctggacatgcacaactatggtcgttaccacggcgaa
ctcatcggctcgagcaaggtgccttacgacgcctacgcatcggtgtggcgcgaactggcc
aagcgcttcaagggtcaccgcggcctgctcggctacgacatcatgaacgagccacacggc
accgttggactctggccaggcgcggcgcaagcggcggtcgatgcgattcgcgaagtcgac
gatcagacgctgatcttcatcgaaggcgagcgctggtccagcgcgtaccactggccgctg
gtgaacgccaacttcctcatcaacgacccggccgaccgcatcgtctacgaagcgcacctg
tatttcgaccaggatttctccggcaagtacatggcgcagaccagccgcgatatcgacccg
atgatcggcgtcgagcgcgctcgcccttttatcgaatggctgaagaaacacggccagcga
ggcttcctcggcgaatacggcattcccgatgacctgcccgaagcggcggtcgccatggac
aacctgctcgcctacctcaatgacaactgcgtacccagcgcctactgggccggcggcccc
ggctggggcacctacaagcttgcaatcgagccgcgcaaaggcgaggaccgtcctcagatg
gagctcatgcgcaaacacctggcgaacgactgcactgccattggccctacacctgcgcac
aacgctgactga

DBGET integrated database retrieval system