KEGG   Pseudomonas stutzeri CCUG 29243: A458_13590Help
Entry
A458_13590        CDS       T02168                                 

Definition
chemotaxis-specific protein-glutamate methyltransferase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A458_13590
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    A458_13590
Enzymes [BR:psc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     A458_13590
Two-component system [BR:psc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   A458_13590
Bacterial motility proteins [BR:psc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    A458_13590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2974414..2975529)
Genome map
AA seq 371 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSSDSNIQVVGTATNGREAIDQVLALKPDVITMDYEMPM
MDGITAVRQIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVKQ
LLCEKVHTVSRSNRRYSTFCTSSVSTPPVSARGTASTLATAAARTGATTPAPAAPAARSP
APKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFADRLDKLCR
IRVKEAEDGDVLRPGLALLAPGGKQMMIDGRGAVRILPGDDRLNYKPCVDVTFGSAAKSF
HDKVLAVVLTGMGADGREGARLLKQSGSQVWAQDEASCVIYGMPMAVVKANLSDAVYGLD
DIGRNLAEACI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcctggtcgtcgacgattccggcttctttcgtcggcgcgtctcggaa
atcctttcctctgattcgaatatccaggtcgtcggcaccgccaccaacggacgcgaggcg
atcgaccaggtgctggcgttgaagccggatgtcatcaccatggactacgagatgccgatg
atggacggcatcacggcggtgcggcagatcatgcagcgctgccccacaccggtgttgatg
ttttcctcgctgacgcacgaaggcgctcgggtcaccctcgatgcgctggatgccggcgcc
gtcgactatctgccgaagaacttcgaagacatttcgcgtaacccggataaggtcaagcag
ctgctgtgcgagaaggtacataccgtttcgcgcagcaaccggcgctacagcacgttctgt
acctcgagcgtaagtacgccgccggtgtccgcgcgcggcactgcctcgacattggctact
gcagccgcccggaccggcgctacaacgccagcgcctgcggcgccggcagcccgttcgcct
gcgcccaagcgcaaggcgtacaagctggtggccatcggtacgtctactggcggtccggtg
gcgctgcagcgtgtgctcactcagctcccggcgaatttccccgcgccgatcgtgctcatc
cagcacatgccggccgcgttcaccaaagccttcgccgatcgtctggacaagctttgccgc
attcgtgtcaaggaggccgaggacggcgacgtgctgcgcccggggcttgctctgctggca
ccgggtgggaagcagatgatgatcgatggccgcggtgcggtacgcatcctgccgggcgat
gatcgcctcaactacaagccttgcgtcgacgttaccttcggttcggccgccaagtcgttt
cacgacaaggtgctggcggtagtgctgaccggcatgggtgccgatggtcgcgaaggcgca
cggttgctcaagcagagcggcagccaggtgtgggcgcaggatgaagccagctgcgtgatc
tatggcatgccgatggcggtggtcaaagccaacctgagtgatgcggtctacgggctcgac
gatatcggtcgcaatctggccgaggcgtgcatctga

DBGET integrated database retrieval system