KEGG   Pseudomonas stutzeri CCUG 29243: A458_15770Help
Entry
A458_15770        CDS       T02168                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Brite
Enzymes [BR:psc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     A458_15770
Secretion system [BR:psc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   A458_15770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3417131..3417856)
Genome map
AA seq 241 aa AA seqDB search
MGVIRLFAAAVAGLASVVVMAADPDQAIRQSLQKIQSDMPIEAIAESPMPGVYQVQLEGG
RQLYASADGQFVIQGYLYQFKDGQAVNLTEQAQSKSVARQINSIPASEMVVFAPKEPKTH
ITVFTDTDCGYCQKLHSEVSQLNRLGVEVRYVAFPRQGMGSHGANTLTSVWCAKDRQDAM
NKAKAREDLPTASCETPIEKQYQLGQMIGVQGTPAIILANGQMIPGYQPAAQLAEVALAA
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgattcgtttgttcgctgccgccgttgcaggtctggccagcgttgttgtaatg
gccgccgatccggatcaggcgattcgccagtctttgcagaagatccagtcggacatgccc
atcgaggctattgccgagagcccgatgcccggggtttatcaggttcagctggagggcggg
cggcagctgtatgccagcgctgatgggcagttcgtcatccagggctatctctaccagttc
aaggatggtcaggccgtcaacctgaccgagcaagctcaaagcaagtcggtggccaggcag
atcaactcaatcccggccagcgagatggtagtgttcgcgcccaaggaacccaagacccat
atcaccgtatttaccgatactgactgtggctactgccagaagctgcacagcgaggtttcg
cagttgaaccgcctcggcgttgaggttcgctatgtcgcgtttccgcggcagggcatgggt
agtcatggggccaataccctgaccagcgtgtggtgcgccaaggatcgccaggacgccatg
aacaaggccaaggcacgtgaagatctgcccacagccagctgcgagacgcctatcgaaaag
cagtatcagcttggccagatgatcggcgtacagggcacgcctgccatcattctcgccaac
ggtcagatgattcccggctatcagccggccgcccaattagcagaagttgcgctcgctgcc
gagtaa

DBGET integrated database retrieval system