KEGG   Pseudomonas stutzeri CCUG 29243: A458_16075Help
Entry
A458_16075        CDS       T02168                                 

Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A458_16075
   00670 One carbon pool by folate
    A458_16075
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     A458_16075
    1.5.1.-  
     A458_16075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3475456..3476160
Genome map
AA seq 234 aa AA seqDB search
MHQAPILITGASQRIGLHCAERLLEDGFPVILTYRRERDSIDRLRALGAQALQADFSDET
GITTFISALKQQTDCLRAIVHNASEWRPDTPGQEAEAFRQLFQVHMLAPYLINLHCAELL
RRGGPADIVHIGDDVTRKGSKKHIAYAASKAGLDNLTLSFAASLAPAIKVNGIAPALIQF
NPDDDAEYRRKALAKSALGIEPGAEVIYQSLRYLFDNPYVTGTTLTVNGGRHLI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggccccgattctcatcaccggagccagccagcggatcgggctgcattgtgcc
gagcgactgctggaagacggcttcccggtcatccttacctaccgccgcgaacgcgacagc
atcgaccggcttcgcgcccttggcgcacaggcgctgcaggcggacttcagcgatgaaacc
ggcatcaccacctttatcagcgctctcaagcagcagaccgactgcctgcgggccatcgtg
cacaacgcctccgaatggcgcccggatacccccgggcaggaagccgaggcgttccgccag
ctgttccaggtgcatatgctcgcgccctacctgatcaacctgcactgcgccgaactgctg
cgccgcggcgggccggcggacatcgtgcacatcggcgacgacgtgacccgcaagggcagc
aagaagcacatcgcctatgctgcgagcaaagcgggcctggacaacctgacactatctttc
gccgccagcctggcgccggcgatcaaggtcaatggcatcgctccggcgctgatccagttc
aacccggacgacgacgccgaatatcgccgcaaggcactggccaagtccgcgctgggcatc
gaacccggtgccgaggtgatctaccagagcctgcgctacctgttcgacaacccttatgtc
accggcaccacactgaccgtgaacggcggccgccacctgatctga

DBGET integrated database retrieval system