KEGG   Pseudomonas stutzeri CCUG 29243: A458_17030Help
Entry
A458_17030        CDS       T02168                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3670113..3671102
Genome map
AA seq 329 aa AA seqDB search
MTSAANADELRERANAMFKPIPDKVTEVRGQKVSEDQAMLGHKLWFDPRLSSSHVISCNT
CHNLSIGGSDNVPTSIGHGWQKGPRNSPTVLNAVFNAAQFWDGRAKDLQEQAKGPVQASV
EMNSTPERVVSTLQSIPEYAAEFRKAFPNDKEPVSFDNMAYALEAFEVSLTTPNSPFDRF
LKGEDGALDDKQKQGLALFMDAGCSSCHNGVNLGGQGYFPFGVIKKPGAEVLPTGDKGRF
AVTNTASDEYVFRAAPLRNVALTPPYFHSGEVWELEQAVAIMGDSQLGRKLDKDEVSAIT
AFLHSVTGEQPQVAYPVLPASTANTPKPE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcagcgaacgctgatgagctgcgtgagcgcgccaacgcgatgttcaaaccg
attcccgacaaggtcaccgaggtccgcggccagaaggtcagcgaagatcaggcaatgctc
ggtcacaaactctggttcgacccgcgcctgtccagcagtcacgtcatcagctgcaacacc
tgccacaacctgagcatcgggggcagcgacaacgtgccaacctcgatcggtcacggctgg
cagaagggcccgcgcaactcgcccaccgtgctgaacgccgtattcaacgccgcgcagttc
tgggatggacgcgccaaggatcttcaggaacaggccaagggcccggtccaggcaagcgtg
gaaatgaacagtacgcccgagcgtgtcgtctcgacgctgcagagcattccggagtacgcc
gccgagttcaggaaggccttccccaacgacaaggagccggtcagtttcgacaacatggcc
tacgccctggaagccttcgaagtcagcctgaccacgccgaactcgccgttcgaccgcttc
ctcaagggtgaggacggggcgctggacgacaagcagaaacagggtctcgccctgttcatg
gacgccggctgctcttcctgccacaacggcgtcaaccttggtggccagggttacttcccc
ttcggcgtgatcaagaagcccggagccgaagtgctgccgaccggcgacaagggtcgcttc
gcggtgaccaataccgccagcgacgagtacgtcttccgtgccgcgccgctgcgcaatgtc
gcgctgaccccgccgtacttccacagcggtgaggtctgggagctcgaacaggccgttgcc
atcatgggtgacagccaactgggccgtaaactggacaaggacgaagtcagcgcgattacc
gcgttcctgcacagcgtgaccggcgagcagccgcaagtcgcctatccggtacttcccgcc
agcaccgcgaacactccgaagcccgagtga

DBGET integrated database retrieval system