KEGG   Pseudomonas stutzeri CCUG 29243: A458_17500Help
Entry
A458_17500        CDS       T02168                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    A458_17500
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    A458_17500
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     A458_17500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3770444..3771214
Genome map
AA seq 256 aa AA seqDB search
MNLTGKTALVTGSTSGIGLGIALKLAEAGADLILNGFGDATAALAEVGRHGHKVGHHGAD
VSDPAQIAELFAYAERDFGGVDILVNNAGIQHVAPVEEFPVERWDAIIAINLSSAFHTTR
LALPGMRQRGWGRIINIASVHGLVGSEQKAAYVAAKHGLVGLTKVVALETATTPITCNAI
CPGWVLTPLVQQQIDERARESGDEQRARHDLLAEKQPSLDFVTPAQLGAMALFLCSEAGD
QVRGAAWNMDGGWAAR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcacaggcaagaccgcactggtcaccggctccaccagcggcatcggcctcggc
atcgcgctgaagctggccgaagccggcgccgacctgattctcaacggcttcggtgatgcc
acggcagcgctggctgaagtcggccgccatggccacaaggtcggccaccacggtgcggac
gtgtccgacccagcgcagatcgccgagctgttcgcctacgccgagcgcgacttcggcggc
gtcgacatcctggtcaacaatgccggcatccagcacgtggcgccggtggaggagttcccg
gtcgaacgctgggacgccatcatcgccatcaacctgtcctcggcattccacaccacacgc
ctggcgctgcccggcatgcgccagcgcggctgggggcggatcatcaatatcgcctcggtg
cacgggctggtgggctccgagcagaaggccgcctacgtcgccgccaagcacgggctggtc
gggctgaccaaggtcgtcgcgctggaaaccgccaccaccccgatcacctgcaatgccatc
tgccccggctgggtgctgaccccgctggtacagcagcagatcgacgagcgcgcgcgggag
agcggcgacgagcaacgcgcccgccacgacctgctcgccgagaagcagccttcgctggat
ttcgtcacccccgcgcagctgggtgcgatggcgctgttcctctgcagcgaggccggcgat
caggtacgcggcgccgcgtggaacatggacggcggctgggcagcgcgctga

DBGET integrated database retrieval system