KEGG   Pseudomonas stutzeri CCUG 29243: A458_18425Help
Entry
A458_18425        CDS       T02168                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3960352..3960894)
Genome map
AA seq 180 aa AA seqDB search
MSLTPVMLGLGSNVQRIERLHAGLDALAELLQDMRCSPVFESLAVGYRGDNFYNLVVAGY
TDLPLTELDRRLKFIEADNGRYAPDRKGLPLDIDVLLYGELVGNFHGLLLPRAEILKNAF
VLWPLALLAPTVKHPAAGEAFADLWAQSSIDQQLWPVPFQWRGSELTPADLIRNHPPQRA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgacccccgtcatgctcggcctgggcagcaatgtgcagcgcatcgagcgcctg
catgccgggctcgatgcgctggccgagctgctgcaggatatgcgttgctcgccagtgttc
gagagcctggcggtgggctataggggcgacaacttctacaacctggtggtcgccggctac
accgacctgccgctgacggaactggaccgccggctcaagttcatcgaggcggacaacggc
cgttacgcgccggatcgcaaggggttgccgctggatatagatgtgctgctgtatggcgag
ctggtcggcaacttccatggcttgctgctgccgcgtgcggagatcttgaagaacgccttc
gtgctctggccgctggcgttattggcgccgaccgtcaaacatcccgctgcaggcgaggcc
tttgccgatctgtgggcgcagtcatccatcgaccagcagctctggccggtgccgtttcag
tggcgcggcagcgagcttacgcctgccgatctgatccgcaaccatcctccacagcgcgcc
tga

DBGET integrated database retrieval system