KEGG   Pseudomonas stutzeri CCUG 29243: A458_18685Help
Entry
A458_18685        CDS       T02168                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A458_18685
Enzymes [BR:psc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     A458_18685
Exosome [BR:psc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A458_18685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4025023..4026036)
Genome map
AA seq 337 aa AA seqDB search
MSFVPASRLFPATRLRRNRRDDFSRRLVRENVLTVDDLILPVFVLDGENRREPVPSMPGV
ERLSIDLLLEEAEELVALGIPALALFPVTPLEKKSLDAAEAWNPEGIAQRATRALRARFP
ELGIITDVALDPFTTHGQDGILDDNGYVQNDVTVDALVRQALSHAEAGAQVVAPSDMMDG
RIQAIREALEVAEHHNVRIMAYSAKYASAYYGPFRDAVGSAANLGKSNKNTYQMDPANGD
EALHEVGADLAEGADMVMVKPGLPYLDIVWRVKDAFKAPTFVYQVSGEYAMHMAAIQNGW
LSEAVILESLVGFKRAGADGILTYFAKQAAQQLKRGQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttcgttcctgccagccggctgttccccgctactcgtctgcgtcgcaatcgtcgt
gacgatttttcccgccgtctggtgcgcgaaaatgtgctgaccgtcgatgacctgatcctg
ccggtgttcgtgctcgacggcgagaaccgccgcgagccggtgccgtcgatgccgggagtg
gagcgactgtccatcgacctgctgctcgaggaggctgaagagctggtggcgctgggcatt
ccggcgctggcgctgtttccggtgacaccgctggagaagaagtccctcgatgcggccgaa
gcctggaacccggagggcatcgcccagcgcgccacgcgcgccttgcgcgcgcgtttccct
gagctggggatcatcaccgacgtagctctcgatcctttcaccacgcacggccaggacggc
attctcgacgacaacggatacgtgcagaacgatgtcactgtcgacgcgctggtccgccag
gcgctgtcccacgccgaagccggcgctcaggtggtcgcgccgtcggacatgatggatggt
cgtatccaggcgattcgcgaggcgctggaagtggccgaacaccacaacgtgcgcatcatg
gcctactcggcgaaatacgccagcgcctattacggcccgttccgagatgcggtgggctct
gccgccaacctcggcaagagcaacaagaatacctatcagatggacccggccaacggtgac
gaggcgctgcacgaagtgggcgccgacctggccgaaggcgcggacatggtgatggtcaag
cccggtctgccctacctggatatcgtctggcgggtcaaagatgccttcaaggcgccgacc
ttcgtctatcaggtcagcggcgagtacgccatgcacatggccgccatccagaatggctgg
ctgagcgaggccgtcatccttgagtctttggtcggcttcaagcgtgccggggccgatggc
atcctgacttacttcgccaaacaggcggcacaacaattaaaacggggccagtga

DBGET integrated database retrieval system