KEGG   Pseudomonas stutzeri CCUG 29243: A458_19045Help
Entry
A458_19045        CDS       T02168                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00010  Glycolysis / Gluconeogenesis
psc00030  Pentose phosphate pathway
psc00051  Fructose and mannose metabolism
psc00052  Galactose metabolism
psc00230  Purine metabolism
psc00500  Starch and sucrose metabolism
psc00520  Amino sugar and nucleotide sugar metabolism
psc00521  Streptomycin biosynthesis
psc01100  Metabolic pathways
psc01110  Biosynthesis of secondary metabolites
psc01120  Microbial metabolism in diverse environments
psc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A458_19045
   00030 Pentose phosphate pathway
    A458_19045
   00051 Fructose and mannose metabolism
    A458_19045
   00052 Galactose metabolism
    A458_19045
   00500 Starch and sucrose metabolism
    A458_19045
   00520 Amino sugar and nucleotide sugar metabolism
    A458_19045
  Nucleotide metabolism
   00230 Purine metabolism
    A458_19045
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A458_19045
Enzymes [BR:psc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     A458_19045
    5.4.2.8  phosphomannomutase
     A458_19045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV dCache_1
Motif
Other DBs
NCBI-ProteinID: AFM35032
UniProt: I4CY75
Position
4096905..4099475
Genome map
AA seq 856 aa AA seqDB search
MALFKRTAKDSGVLNPADSRSKRGGFTLKPLLGGLAASLIGLGAAAALIWLGQQGAQQQQ
QTQLAEAWSQSQASALQQALRRLRADTQTAVEQQRLVDVVRADTELRREAEQRLLELPGV
VDAHLNPRGRVVPDTSRPGPLNFAALDLLQRVEAGQSAAPEAYKVDNRWLLYSAIPLRAE
GEQAIRGTLLLVSDLQHLFATLPTLPDEAGQLRLTQQFSGAPEQVLLQRGTAADNASALT
LASGNANWKLAYLPGAIDQLTLMPLLLLAAALVAIAGVLIGLQLVLGGQQRRLREDVLQM
SRLLQELSTGKTIQIPALSLPVLDALARNMVRLPVRQVGPAPTQAPAAAPAVRPAKSTEY
VDPRLPDTDILDIDILDEDQDIFGLDTKEREPAMSSAKAPNLPASIFRAYDIRGVVGDSL
TTETAYWVGRAIGSESLAKGEPNVSVGRDGRLSGPELVQHLIQGLLDSGCDVSDIGMVPT
PVLYYAANILAGKSGVMLTGSHNPPDYNGFKIVIAGDTLANEQIQTLRKRIETNDLSSGV
GKVEQVDVLERYFEQIRSDIAMAKPMKVVVDCGNGVAGVIAPRMIEALGCTVIPLYCEVD
GNFPNHHPDPGKPENLVDLIAKVKSEKADLGLAFDGDGDRVGVVTNAGTMIYPDRLLMLF
AKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRPVMWKTGHSLIKKKMKESGALLAGEMS
GHIFFKERWFGFDDGIYSAARLLEILSQDKRDAEQVFAAFPCDISTPEINITVTEESKFT
IMDALQRDAQWGEANLITLDGVRVDYPKGWGLIRASNTTPVLVLRFEADSEEELSRIQDV
FRAQLLNVAPDLKLPF
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggcactcttcaagcgcaccgccaaggattcaggcgttctgaacccggccgacagccgc
agcaagcgcggcggtttcaccctcaagccattgctcggtggcctcgcagccagcctgatc
gggctcggcgctgccgccgcgctgatctggctcggtcagcagggcgctcagcagcagcaa
cagacacaactcgccgaggcctggagccagagccaggcaagcgcattgcagcaggcgctg
cggcggctgcgtgccgatacccagacagcggtggagcagcaacgcctggtggacgtcgtc
cgtgctgacaccgagctcagacgcgaagccgaacagcgcctgctggagttgcccggcgtg
gtcgacgcgcatctcaatccacgcggcagagtggtgccggacaccagccgcccgggcccg
ctgaacttcgctgcgctcgatctgctacagcgggtcgaagcaggccagtcggccgctccg
gaagcctacaaggtcgacaaccgctggctgctctacagtgcgattccgctgcgcgccgag
ggtgagcaggcgattcgcggcacgctgctgctggtcagcgatctccagcacctgttcgcg
acactcccgacgctgcccgacgaagccggccagctgcgactgacccagcaattctccggc
gcacccgaacaggtgctgctgcagcgcggcaccgcagccgacaatgcttcggcactgacc
ctcgccagcggcaacgccaactggaagctggcctacctgcccggtgccatcgatcagctg
accctcatgccgctgctcctgctcgcggccgccctggtggcgattgccggcgtgctgatc
gggctgcagctggtgctcggcggccagcagcgcaggctgcgcgaagacgtgttgcagatg
agccgcctgctacaggaactctctaccggcaagaccatccaaataccggccttgagcctg
ccggtcctcgacgcactggccaggaacatggtccgactgcctgtccgccaagttggaccg
gctccgactcaggcacccgccgcggctccagccgttcggcccgccaaatctaccgagtac
gtcgatccgcgcttgccggacaccgatattctcgacatcgatattctcgacgaggaccag
gacatcttcggcctcgacaccaaggagcgagaacccgcaatgagcagtgccaaagccccg
aatttgcccgccagtatcttccgcgcctacgacatccgtggcgttgtcggcgacagcctg
actaccgagaccgcctactgggtcggccgcgccatcgggtccgagagcctcgccaagggt
gaacccaacgtttcggttggccgcgacgggcgtctgtccggtccagaactggtccagcac
ctcattcaaggtctgctcgacagcggctgcgatgtcagcgatatcggcatggtgccgacg
ccggtgctctattacgccgccaacattctcgccggcaagtccggcgtgatgctcaccggc
agccacaatccgccggactacaacggcttcaagatcgtcatcgccggcgacactctggcc
aacgaacagatccagaccctgcgcaagcgcatcgagaccaacgacctgtccagcggcgtc
ggcaaggtcgagcaggtcgatgtacttgaacgctacttcgagcagattcgcagtgacatc
gccatggccaaaccgatgaaggtggtcgtcgactgcggtaacggcgtcgccggcgtcatc
gccccacgcatgatcgaagcactgggttgcaccgtgatcccgctgtactgcgaggtcgac
ggcaacttcccgaatcaccatccggatccgggcaaaccggaaaatctggtcgacctgatc
gccaaggttaaatccgagaaggccgatctcggtctggctttcgacggcgatggcgaccgc
gtcggcgtggtgaccaacgccggcaccatgatctatccggaccgcctgctgatgctgttc
gccaaggatgtggtatcgcgcaatccaggcgccgacatcatcttcgacgtcaaatgcacc
cgtcgcctcactccactgatcagtggttacggcggccggccggtgatgtggaagaccggc
cattcgctgatcaagaagaagatgaaggagtccggcgcgctgctcgctggcgaaatgagc
gggcacatcttcttcaaggaacgctggttcggcttcgacgacggcatctacagcgccgcg
cgcctgctggaaatcctcagccaggacaagcgtgacgctgagcaggtgttcgccgcattc
ccctgcgatatctcgacaccggagatcaacatcacggtgacagaggaaagcaaattcacc
atcatggacgccctgcaacgtgacgctcagtggggcgaagccaacctgatcaccctcgac
ggtgtacgggtcgactatcccaagggctggggcctgatccgcgcctcgaacaccacaccg
gttctggtgctgcgcttcgaggccgacagcgaggaagaactcagccgcattcaggacgtt
ttccgcgcacagctgctcaacgttgcacccgatctcaaactgccgttctga

DBGET integrated database retrieval system