KEGG   Pseudomonas stutzeri CCUG 29243: A458_19090Help
Entry
A458_19090        CDS       T02168                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:psc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4106443..4107072
Genome map
AA seq 209 aa AA seqDB search
MSATTGTLYIVSAPSGAGKTSLVKALVDAQPQVRVSVSHTTRAMRPGEVDGVNYHFVSRE
DFLARLERNEFLEHAEVFGNLYGTSQRWLEDTLAEGFDLILEIDWQGAQQVRRLMPQAKS
IFILPPTQEALRQRLNNRGQDSDEIIDKRMREAVSEMSHYVEYDYLVINDDFAHALIDLQ
SIFRANQLIQKTQQQRHARLLGELLAQVG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaccaccggtacgctttatatcgtttccgcgccttccggggccggcaagacc
agcctggtcaaggcgctggtcgatgcacaaccgcaggtgcgggtgtcggtttcccatacc
acccgggccatgcggccgggcgaggtcgacggcgtcaactatcacttcgtcagccgcgag
gattttctcgcgcgactggagcgcaacgagtttctcgagcatgccgaagtgttcggcaac
ctgtacggcacctcccagcgctggttggaagacaccctggccgaaggcttcgacctgatc
ctggagatcgactggcagggcgcgcagcaggtgcgccgcctgatgccccaggccaaatcg
atcttcatcctgccgccgacccaggaagcactgcgccaacgcctcaacaaccgcggccag
gacagtgacgagatcatcgacaagcgcatgcgcgaagcggtcagcgaaatgagccactac
gtcgaatacgactacctggtgatcaacgacgacttcgcccacgccctgatcgacctgcag
tcgatcttccgcgccaaccaactgatacagaagacccagcaacagcgccacgcccgcctg
cttggcgaattgctcgcgcaggtcggttga

DBGET integrated database retrieval system