KEGG   Pseudomonas stutzeri CCUG 29243: A458_19090Help
Entry
A458_19090        CDS       T02168                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00230  Purine metabolism
psc01100  Metabolic pathways
Module
psc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A458_19090 (gmk)
Enzymes [BR:psc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     A458_19090 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_22 AAA_16 MMR_HSR1 RsgA_GTPase cobW AAA_30 ABC_tran AAA
Motif
Other DBs
NCBI-ProteinID: AFM35041
UniProt: I4CY84
Position
4106443..4107072
Genome map
AA seq 209 aa AA seqDB search
MSATTGTLYIVSAPSGAGKTSLVKALVDAQPQVRVSVSHTTRAMRPGEVDGVNYHFVSRE
DFLARLERNEFLEHAEVFGNLYGTSQRWLEDTLAEGFDLILEIDWQGAQQVRRLMPQAKS
IFILPPTQEALRQRLNNRGQDSDEIIDKRMREAVSEMSHYVEYDYLVINDDFAHALIDLQ
SIFRANQLIQKTQQQRHARLLGELLAQVG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaccaccggtacgctttatatcgtttccgcgccttccggggccggcaagacc
agcctggtcaaggcgctggtcgatgcacaaccgcaggtgcgggtgtcggtttcccatacc
acccgggccatgcggccgggcgaggtcgacggcgtcaactatcacttcgtcagccgcgag
gattttctcgcgcgactggagcgcaacgagtttctcgagcatgccgaagtgttcggcaac
ctgtacggcacctcccagcgctggttggaagacaccctggccgaaggcttcgacctgatc
ctggagatcgactggcagggcgcgcagcaggtgcgccgcctgatgccccaggccaaatcg
atcttcatcctgccgccgacccaggaagcactgcgccaacgcctcaacaaccgcggccag
gacagtgacgagatcatcgacaagcgcatgcgcgaagcggtcagcgaaatgagccactac
gtcgaatacgactacctggtgatcaacgacgacttcgcccacgccctgatcgacctgcag
tcgatcttccgcgccaaccaactgatacagaagacccagcaacagcgccacgcccgcctg
cttggcgaattgctcgcgcaggtcggttga

DBGET integrated database retrieval system