KEGG   Pseudomonas stutzeri CCUG 29243: A458_19205Help
Entry
A458_19205        CDS       T02168                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A458_19205
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A458_19205
   00630 Glyoxylate and dicarboxylate metabolism
    A458_19205
Enzymes [BR:psc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A458_19205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4129593..4131773)
Genome map
AA seq 726 aa AA seqDB search
MTERVTLGRLQVAANLKRFIEDEVLPGTGIEAAAFWQGLDALVHDLAPKNRELLAERDRL
QLELDTWHRANPGPIKDMAAYRAFLESIGYLLPVPGEVKIETANVDSEIATQAGPQLVVP
IMNARYALNAANARWGSLYDALYGTDAISEEGGAQKGPGYNEVRGAKVIAFARNFLDQAA
PLAEGSHADATAYRVQDGQLKVTLENGSVTGLKQPEKFVGFQGEAVEPKAVLLKNNGLHV
EIQIDPNSPIGQTDAAGVKDLLIESAVSTILDCEDSVAAVDADDKVLAYRNWLGIVQGTL
SEEVAKGNSSFVRRLNPDREYSAPDGGELKLHGRSLLFIRNVGHLMTNPAILLEDGREIP
EGIMDGVFTSLIAKHDLKRKGNSRTGSFYIVKPKMHGPKEVAFADELFGRVEDLIGVPRF
TLKMGIMDEERRTSANLKACIAAAKSRVAFINTGFLDRTGDEMHTCMEAGPVLRKGDMKN
TPWIKSYERNNVLVGLACGLRGKAQIGKGMWAMPDLMAAMLEQKIGHPKSGANTAWVPSP
TGATLHALHYHQVDVQAVQSELEKVDLAAEREQLLNDLLTIPVVAEDKWSAEEKQQELDN
NCQGILGYVVRWVEQGVGCSKVPDIHNVGLMEDRATLRISSQHVANWLHHGVVTREQVQE
TLERMAKVVDQQNAGDPLYRAMSADYTQSAAFQAACDLVFKGREQPAGYTEPLLHAWRRR
FKAAQG
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgtgtaaccctgggccgcctgcaagtcgcggccaatctcaagcgtttcatc
gaagacgaagtcctgccgggcaccggtatcgaagccgccgccttctggcagggcctggat
gccctggtccacgacctggcgccgaagaaccgcgagctgctcgccgagcgcgaccgcctg
cagctcgagctggacacgtggcacagggccaatccgggcccgatcaaggacatggcagcc
taccgcgccttcctcgaatccatcggctacctgctgccggtgccgggcgaggtgaagatc
gagaccgccaacgtcgacagcgagatcgccacccaggccggtccgcagcttgtggtgccg
atcatgaacgcgcgctatgcgctgaacgcggccaacgcccgctggggctcgctgtatgac
gcgctgtacggcaccgacgccatttccgaagagggcggcgcgcagaagggcccgggctac
aacgaagtgcgcggcgccaaggtcatcgcctttgcccgcaacttcctcgaccaggccgcg
ccgctggccgaaggcagccatgccgacgccaccgcctaccgcgtgcaggatggccagctc
aaggtcaccctggagaacggcagcgtcaccggcctcaagcagccggagaaattcgtcggc
ttccagggcgaagcggtcgagccgaaagccgtgctgctgaagaacaacggcctgcacgtc
gaaatccagatcgacccgaacagcccgatcggccagaccgatgccgccggcgtgaaggac
ctgctgattgagtccgccgtgtcgaccatcctcgactgcgaagactcggtcgccgcggtg
gatgccgacgacaaggtgctggcctaccgcaactggctgggcatcgtgcagggcaccctc
agcgaggaagtggccaagggcaactccagcttcgtccgtcgcctcaacccggaccgcgaa
tacagcgcgccggacggcggcgagctgaaactgcacggccgctcgctgctgttcatccgt
aacgtcggccacctgatgaccaacccggcgatcctcctggaagacggccgcgagatcccg
gaaggcatcatggacggcgtgttcaccagcctgatcgccaagcatgacttgaagcgcaag
ggcaactcgcgcaccggcagcttctacatcgtcaagccgaagatgcacgggccgaaggaa
gtcgccttcgccgacgagctgttcggccgcgtcgaggacctgatcggcgtaccgcgcttc
accctgaagatgggcatcatggacgaggagcgccgcaccagcgccaacctcaaggcctgc
atcgccgcggccaagagccgtgtggccttcatcaataccggcttcctcgaccgcaccggt
gacgagatgcacacctgcatggaagccggcccggtgctgcgcaagggcgacatgaagaac
acgccgtggatcaagtcctacgagcgcaacaacgtgctggtcggcctggcctgcggcctg
cgcggcaaggcgcagatcggcaagggcatgtgggccatgccggacctgatggcggccatg
ctcgagcagaagatcggccacccgaagtccggcgccaacaccgcctgggtgccgtcgccg
accggtgccaccctgcatgcgctgcactaccaccaggtcgacgtgcaggcggtgcagagc
gagctggaaaaggtcgacctggccgccgagcgcgagcagctgctcaacgatctgctgacc
attccggtggtcgccgaggacaagtggagcgctgaggagaagcagcaggagctggacaac
aactgccagggcatcctcggctacgtggtgcgctgggtcgagcagggcgttggctgctcc
aaggtgccggacatccacaacgtcggcctgatggaggaccgcgccaccctgcgtatctcc
agccagcacgtggccaactggctgcaccatggcgtggtgacccgcgagcaggtgcaggaa
accctggagcgcatggccaaggtggtcgaccagcagaatgccggtgatccgctctatcgc
gccatgtctgccgactacactcagtcggcggccttccaggcggcctgtgatctggtgttc
aaggggcgcgagcagccggccggttataccgagcctctgctgcacgcctggcgccggcgt
ttcaaggcggcccagggctga

DBGET integrated database retrieval system