KEGG   Pseudomonas stutzeri CCUG 29243: A458_19205Help
Entry
A458_19205        CDS       T02168                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00620  Pyruvate metabolism
psc00630  Glyoxylate and dicarboxylate metabolism
psc01100  Metabolic pathways
psc01110  Biosynthesis of secondary metabolites
psc01120  Microbial metabolism in diverse environments
psc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A458_19205
   00630 Glyoxylate and dicarboxylate metabolism
    A458_19205
Enzymes [BR:psc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A458_19205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFM35064
UniProt: I4CYA7
Position
complement(4129593..4131773)
Genome map
AA seq 726 aa AA seqDB search
MTERVTLGRLQVAANLKRFIEDEVLPGTGIEAAAFWQGLDALVHDLAPKNRELLAERDRL
QLELDTWHRANPGPIKDMAAYRAFLESIGYLLPVPGEVKIETANVDSEIATQAGPQLVVP
IMNARYALNAANARWGSLYDALYGTDAISEEGGAQKGPGYNEVRGAKVIAFARNFLDQAA
PLAEGSHADATAYRVQDGQLKVTLENGSVTGLKQPEKFVGFQGEAVEPKAVLLKNNGLHV
EIQIDPNSPIGQTDAAGVKDLLIESAVSTILDCEDSVAAVDADDKVLAYRNWLGIVQGTL
SEEVAKGNSSFVRRLNPDREYSAPDGGELKLHGRSLLFIRNVGHLMTNPAILLEDGREIP
EGIMDGVFTSLIAKHDLKRKGNSRTGSFYIVKPKMHGPKEVAFADELFGRVEDLIGVPRF
TLKMGIMDEERRTSANLKACIAAAKSRVAFINTGFLDRTGDEMHTCMEAGPVLRKGDMKN
TPWIKSYERNNVLVGLACGLRGKAQIGKGMWAMPDLMAAMLEQKIGHPKSGANTAWVPSP
TGATLHALHYHQVDVQAVQSELEKVDLAAEREQLLNDLLTIPVVAEDKWSAEEKQQELDN
NCQGILGYVVRWVEQGVGCSKVPDIHNVGLMEDRATLRISSQHVANWLHHGVVTREQVQE
TLERMAKVVDQQNAGDPLYRAMSADYTQSAAFQAACDLVFKGREQPAGYTEPLLHAWRRR
FKAAQG
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgtgtaaccctgggccgcctgcaagtcgcggccaatctcaagcgtttcatc
gaagacgaagtcctgccgggcaccggtatcgaagccgccgccttctggcagggcctggat
gccctggtccacgacctggcgccgaagaaccgcgagctgctcgccgagcgcgaccgcctg
cagctcgagctggacacgtggcacagggccaatccgggcccgatcaaggacatggcagcc
taccgcgccttcctcgaatccatcggctacctgctgccggtgccgggcgaggtgaagatc
gagaccgccaacgtcgacagcgagatcgccacccaggccggtccgcagcttgtggtgccg
atcatgaacgcgcgctatgcgctgaacgcggccaacgcccgctggggctcgctgtatgac
gcgctgtacggcaccgacgccatttccgaagagggcggcgcgcagaagggcccgggctac
aacgaagtgcgcggcgccaaggtcatcgcctttgcccgcaacttcctcgaccaggccgcg
ccgctggccgaaggcagccatgccgacgccaccgcctaccgcgtgcaggatggccagctc
aaggtcaccctggagaacggcagcgtcaccggcctcaagcagccggagaaattcgtcggc
ttccagggcgaagcggtcgagccgaaagccgtgctgctgaagaacaacggcctgcacgtc
gaaatccagatcgacccgaacagcccgatcggccagaccgatgccgccggcgtgaaggac
ctgctgattgagtccgccgtgtcgaccatcctcgactgcgaagactcggtcgccgcggtg
gatgccgacgacaaggtgctggcctaccgcaactggctgggcatcgtgcagggcaccctc
agcgaggaagtggccaagggcaactccagcttcgtccgtcgcctcaacccggaccgcgaa
tacagcgcgccggacggcggcgagctgaaactgcacggccgctcgctgctgttcatccgt
aacgtcggccacctgatgaccaacccggcgatcctcctggaagacggccgcgagatcccg
gaaggcatcatggacggcgtgttcaccagcctgatcgccaagcatgacttgaagcgcaag
ggcaactcgcgcaccggcagcttctacatcgtcaagccgaagatgcacgggccgaaggaa
gtcgccttcgccgacgagctgttcggccgcgtcgaggacctgatcggcgtaccgcgcttc
accctgaagatgggcatcatggacgaggagcgccgcaccagcgccaacctcaaggcctgc
atcgccgcggccaagagccgtgtggccttcatcaataccggcttcctcgaccgcaccggt
gacgagatgcacacctgcatggaagccggcccggtgctgcgcaagggcgacatgaagaac
acgccgtggatcaagtcctacgagcgcaacaacgtgctggtcggcctggcctgcggcctg
cgcggcaaggcgcagatcggcaagggcatgtgggccatgccggacctgatggcggccatg
ctcgagcagaagatcggccacccgaagtccggcgccaacaccgcctgggtgccgtcgccg
accggtgccaccctgcatgcgctgcactaccaccaggtcgacgtgcaggcggtgcagagc
gagctggaaaaggtcgacctggccgccgagcgcgagcagctgctcaacgatctgctgacc
attccggtggtcgccgaggacaagtggagcgctgaggagaagcagcaggagctggacaac
aactgccagggcatcctcggctacgtggtgcgctgggtcgagcagggcgttggctgctcc
aaggtgccggacatccacaacgtcggcctgatggaggaccgcgccaccctgcgtatctcc
agccagcacgtggccaactggctgcaccatggcgtggtgacccgcgagcaggtgcaggaa
accctggagcgcatggccaaggtggtcgaccagcagaatgccggtgatccgctctatcgc
gccatgtctgccgactacactcagtcggcggccttccaggcggcctgtgatctggtgttc
aaggggcgcgagcagccggccggttataccgagcctctgctgcacgcctggcgccggcgt
ttcaaggcggcccagggctga

DBGET integrated database retrieval system