KEGG   Phialocephala scopiformis: LY89DRAFT_505711Help
Entry
LY89DRAFT_505711  CDS       T04865                                 

Definition
(RefSeq) Arabinanase/levansucrase/invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
psco  Phialocephala scopiformis
Pathway
psco00052  Galactose metabolism
psco00500  Starch and sucrose metabolism
psco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LY89DRAFT_505711
   00500 Starch and sucrose metabolism
    LY89DRAFT_505711
Enzymes [BR:psco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LY89DRAFT_505711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975 Glyco_hydro_43
Motif
Other DBs
NCBI-GeneID: 28817743
NCBI-ProteinID: XP_018073179
JGI: 505711
UniProt: A0A194XFB4
Position
Unknown
AA seq 559 aa AA seqDB search
MEFSRFRPTPHFIAPHSWMNDPCGAVYIPETREYILCYQWNPGTAEGGNCAWGMAKSKDL
VTWEDCSPALRNGPTYDRLGVFSGSIVSRVIDGQRVLFLFYTSVSAVPIHWSKDYIEDCE
SQSVAFSKDFGVSWHRYEHNPLMRNPPRESRTTGWRDPFVSPWKGLSELLGVDPKTDYMM
IASGVKGHGSELHLYQSNNLLDWKPVSTILSVKAGSRVSSKSNLRFGMNFECASFFSIGQ
RHYIIVGVEEDEGSKYHNGHYLMWLSGQLILEDGLPKFEITSHGLLDHGISYAAHIFRDS
EGRLIQLGWADETTKQNIRNKQGWAGCLAHPRELFEISRPITEDGKDLDIWDVDEEKGTM
TTLGVRPAPQLTNLQQNTKPTSSLESISTIRSKNYRVEATFKGLSGHERFIFRVRVSISE
VTKIIVDLKAGQIIVDRSQSSFEKLGTDSPDSGFFTLLAREDLRINIFVDNSIIEVYAND
RFALTSRIYPCLETSIGASYDFGGFDERNIELLCWEKLKSVWPLRNDGEGSLDMKCTEKK
TVDETLKAKPIVMEAAIFA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggagttcagtcgctttcgaccaacaccacacttcatcgcaccccattcttggatgaac
gacccatgcggcgcagtctacataccagaaacccgagaatatatcctatgctaccaatgg
aaccccggaactgccgaaggagggaactgtgcttggggtatggcaaaaagcaaagacctc
gtcacttgggaggattgctctccagcactcagaaatggaccaacttacgaccgcttagga
gtcttttcaggatccatcgtttcgagggtgattgatggacagcgagtacttttcttgttc
tacactagtgtctcagctgtcccgatacattggtcgaaagactatatcgaagattgcgaa
tcacagtccgtggcattttcgaaagactttggagtgtcgtggcatcgatatgaacataat
cccttgatgagaaatcctcccagagaatcgaggacaacaggatggagagatccttttgta
tcaccatggaaaggtctctcggaactgcttggagtggatccaaaaacagactacatgatg
attgcgtccggagtgaaaggtcacgggtcagagttgcatctgtaccaatcaaataatctg
cttgactggaagccagtgtcgacaattctcagtgtcaaagcggggtctagagtatcatca
aagagcaatctgagattcggcatgaattttgaatgtgcgagcttcttcagtattgggcaa
agacactacatcattgttggcgttgaggaggatgaaggtagcaagtatcacaatgggcat
tacttgatgtggctttctggtcagctgatactggaggatggtttacccaaattcgagatc
acgagtcatggcctgctggatcatggtatctcatacgctgctcacatattccgagactcg
gaaggacgacttatccaacttggctgggcagatgaaaccacgaagcaaaatatcagaaat
aagcaaggatgggcaggttgcttagctcacccgcgggaactgttcgagatatcgaggcca
attacggaagatggcaaagatcttgatatttgggacgtcgatgaagagaaaggtacaatg
accacgctcggagtcagacctgcgcctcaacttacaaaccttcaacaaaacaccaaaccg
acatcatcacttgagtcgatatcgacgattcggtccaaaaactaccgggtcgaggcgact
ttcaaagggctttccggtcatgaaagattcattttcagagttcgagtgtctatttctgaa
gttaccaagattatcgttgacctaaaggcgggccaaatcattgttgataggagccaatcc
tccttcgaaaaactcgggactgactctccagactcggggtttttcactcttcttgccaga
gaagatctacgaattaatattttcgtagacaattctatcattgaagtctatgcgaatgac
cgatttgctttgacgtcaagaatttatccttgtctcgagacttcgattggtgcgtcgtac
gattttggagggtttgatgagagaaatattgagcttctgtgctgggagaaattgaagagc
gtctggcctttgcggaatgatggtgaggggtcactggacatgaagtgtacggaaaaaaaa
acagtagatgagactttgaaggcgaagccgattgtgatggaagcggccatctttgcctga

DBGET integrated database retrieval system