KEGG   Pseudoxanthomonas spadix: DSC_00140Help
Entry
DSC_00140         CDS       T01643                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DSC_00140
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DSC_00140
Enzymes [BR:psd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     DSC_00140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3265743..3267047)
Genome map
AA seq 434 aa AA seqDB search
MSKLRTADQIQKEWDTDPRWKGITRNYTAADVVRLRGTIPVEHSLARLGAQKLWTSLHSQ
DFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVKR
INNTLLRADQLQHAEREPGCSDDSIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGV
HFEDQLASVKKCGHMGGKVLVPTREAVEKLNAARLAADVMGVPTLLIARTDAEAADLLTS
DVDPNDAPFTTGERTVEGFYKTRKGLDQAISRGLAYAPYADLIWCETGKPDLEFARAFAD
AIHARFPGKLLAYNCSPSFNWSKHLDEATIARFQKEIAGYGYKFQFITLAGFHALNYSMF
NLAYGYAREQMKAFVELQEAEFAAAPKGFTAVKHQREVGTGYFDAVTQAIQQNQSSTTAL
TGSTEEEQFTTRAA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgcgcaccgccgaccagatccagaaggagtgggacaccgatccgcgctgg
aagggcatcacccgcaactacaccgccgccgatgtggtgcgcctgcgcggcaccatcccg
gttgagcactccctcgccaggctcggtgcccagaagctgtggacgtcgctgcacagccag
gacttcgtcaacgccctgggcgcgctgaccggcaaccaggccatgcagcaggtcaaggcc
ggactgaaggcgatctacctgtccggctggcaggtcgccgccgatgccaacctggccggg
cagatgtatccggaccagtcgctgtatccggccgactcggtgccggcggtggtcaagcgc
atcaacaacaccctgctgcgcgccgaccagctgcagcatgcggaaagagaaccaggatgc
agcgatgacagcatcgacttcctgcagccgatcgtggccgatgccgaggccggtttcggc
ggcgtgctcaatgccttcgagctgatgaaggcgatgatcgaggccggcgcggccggggtg
cacttcgaggaccagctggcctcggtgaaaaagtgcggccacatgggcggcaaggtgctg
gtgcccacccgcgaggcggtggagaagttgaacgccgcgcgcctggccgccgacgtcatg
ggcgtgccgaccctgctgatcgcgcgcaccgatgccgaagccgccgaccttctgaccagc
gacgtggatcccaacgatgcgccgttcaccaccggcgagcgcaccgtcgaaggcttctac
aagacccgcaagggcctggaccaggcgatcagccgcggcctggcctacgcgccctatgcc
gacctgatctggtgcgagactggcaagccggacctggagtttgccagggcctttgccgat
gcgatccatgccaggttccccggtaagctgctggcctacaactgctcgcccagcttcaac
tggagcaagcacctggacgaggcgaccatcgccaggttccagaaggaaatcgcaggctac
ggctacaagttccagttcatcaccctggccggtttccatgcgctgaactactccatgttc
aacctggcctatggttatgcgcgcgagcagatgaaggccttcgtggagctgcaggaagcc
gagttcgccgccgcacccaagggcttcaccgcggtcaagcaccagcgcgaagtgggcacc
ggctacttcgatgcggtcacccaggcgatccagcagaaccagtcctcgaccaccgccctg
accggctcgaccgaagaggaacagttcaccacccgggcggcctga

DBGET integrated database retrieval system