KEGG   Pseudoxanthomonas spadix: DSC_00145Help
Entry
DSC_00145         CDS       T01643                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DSC_00145
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DSC_00145
   00630 Glyoxylate and dicarboxylate metabolism
    DSC_00145
Enzymes [BR:psd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DSC_00145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3267245..3268891)
Genome map
AA seq 548 aa AA seqDB search
MSAPAHALPPRDPAIAGATPGLALTRQDPGQDALLPPALLALLVSLHRAIEPGRQARLAQ
RQLRQAEFDSGALPDFRTDTAAVREGDWTVAPIPAALLDRRVEITGPTDPKMVINALNSG
AKVFMADFEDSTSPTWSNLLTGQRALIGAVAGDLQFAAPATGGKPGKHYTLKPYEQQAVL
IVRPRGWHLDEKHVLIDGAPIAAGLFDVAVFAFHNARTLQARDRGPYFYLPKLQSMEEAA
LWESALSHIEAVLGLAQGQMKVTVLIETLPAVFEMHEILHALRSRIVGLNCGRWDYIFSY
IKTLRAHPDRVLPERGQVTMTQPFLKAYSELLIQTCHRRGAHAMGGMAAQIPINDDPVAN
EQAMARVRADKLREVSAGHDGTWVAHPALIPVAMQIFDEHMPQPNQHAVTRADVHVSRDD
LIRPSQGTISRAGFEGNVEVCVRYLAAWLDGNGCVPIHWLMEDAATAEISRAQLWQWLHT
EGLHLDDGTAIDEALLQATLTRLPALLGNTTAMPGASKVDQAIALLDELSRSQTLAEFLT
LPAYALID
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacctgcccatgccttgccaccgcgtgatccggccatcgccggggccacgccg
gggctggcgctgacccgccaggaccccggccaggacgcgctgctgccgccggccctgctg
gcgctgctggtgagcctgcaccgggccatcgagccgggccgccaggcgcggctggcccag
cgccagctccgccaggccgagttcgacagcggcgccctgccggacttccgcaccgacacc
gccgccgtgcgcgaaggcgactggaccgtcgcaccgatcccggccgcattgctggaccgc
cgggtggagatcaccggcccgaccgatccgaagatggtgatcaatgcgctcaactccggc
gccaaggtgttcatggccgatttcgaggattcgacctcgccgacctggagcaacctgctg
accggccagcgcgcgctgatcggcgcggtcgccggcgacctgcagttcgcagcgccagcc
acgggcggcaagcccggcaagcactacacgctgaagccatatgaacaacaggccgtgctg
atcgtgcgtccgcgcggctggcacctggacgagaagcacgtgctcatcgatggcgcgccg
atcgccgccggcttgttcgacgtggcggtgttcgccttccacaacgcgcgcacgctgcag
gccagggatcgcggcccgtacttctacctgcccaaactgcagtcgatggaagaggccgcg
ctgtgggagtcggcgctgtcgcatatcgaggcggtgctgggcctggcgcaggggcagatg
aaggtgaccgtgctgatcgagacgctgccggcggtgttcgagatgcacgagatcctgcat
gcgctgcgcagccgcatcgtcggcctgaactgcggccgctgggactacatcttttcctac
atcaagaccttgcgcgcccatccggaccgggtgctgcccgagcgcggccaggtcaccatg
acccagccgttcctgaaggcctattcggagctgctgatccagacctgccaccggcgcggc
gcccatgcgatgggcggcatggccgcgcagatcccgatcaacgacgacccggtcgccaac
gaacaggccatggcccgggtgcgcgccgacaagctgcgcgaggtgagcgccggccacgac
ggcacctgggtcgcgcacccggcgctgatcccggtggcgatgcagatcttcgacgagcac
atgccgcagcccaaccagcacgcggtcacccgcgccgatgtgcacgtgagccgcgacgac
ctgatccggccctcgcagggcacgatcagccgcgccggatttgaaggcaacgtcgaggtc
tgcgtgcgctatctggcggcatggctggacggcaacggctgcgtgcccattcactggctg
atggaagacgcggccaccgcggaaatctcgcgcgcccagctgtggcaatggctgcacacc
gagggcctgcacctggacgacggcaccgcgatcgacgaggcactgctgcaggccacgctc
acgcggctgcctgcgctgctgggcaacaccacggccatgcccggggcgagcaaggtcgac
caggccatcgccctgctggatgaactttcgcgcagccagacgctggccgagtttctcacc
ctgccggcgtacgcattgatcgactga

DBGET integrated database retrieval system