KEGG   Pseudoxanthomonas spadix: DSC_00320Help
Entry
DSC_00320         CDS       T01643                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DSC_00320
Enzymes [BR:psd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     DSC_00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3301009..3301416)
Genome map
AA seq 135 aa AA seqDB search
MTTRRYVLLLGSSLESPQVLRLAAELLSAQGLVEATSRCVQGPSVSAGDARHFHNQALVL
ACGLSPDALVPWLKATEAELGRVPGQAQCVIDIDLACECDAHGIVLWRDDAKLRHPLFVS
LMQEVLDQLRGQPGS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccggcgctacgtgctgctgctgggcagcagcctggaatcaccgcaggtgctg
cgcctggccgccgagctgctgtcggcgcagggcctggtcgaagcgacctcgcgctgcgtg
caaggccccagcgtcagcgccggcgatgcgcgccacttccacaaccaggcgctggtgttg
gcctgcgggctgagccccgatgcgctggtgccctggctgaaggcgaccgaagccgaactg
ggccgcgtgcccggccaggcgcagtgcgtgatcgacatcgacctggcctgcgaatgcgac
gcacacggcatcgtgctgtggcgcgacgatgccaagctccggcatccgctgttcgtcagc
ctgatgcaggaggtactggaccagctgcgcgggcagcctggatcgtag

DBGET integrated database retrieval system