KEGG   Pseudoxanthomonas spadix: DSC_01130Help
Entry
DSC_01130         CDS       T01643                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    DSC_01130
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DSC_01130
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DSC_01130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32996..33541
Genome map
AA seq 181 aa AA seqDB search
MTTLYDIPLKTIQDQPTTLADYRGKVLLVVNVASKCGLTPQYEGLEALYRAKHDAGLEVL
GFPANNFMEQEPGSNAEIASFCSANFDVTFPLFSKISVAGNAVHPLYQALVDAQPVATGE
GPLREKLKSMDIKVNPAPGVTWNFEKFLIGRDGRVLARFAPDVGPDDPRLLQAVDAALAA
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacgactctgtacgacatcccgctgaagaccatccaggaccagcccaccaccctggcc
gactaccgcggcaaggtcctgctggtggtcaatgtggcctccaagtgcggcctgaccccc
cagtacgaagggctggaggcgctgtaccgggccaagcacgatgcgggcctggaagtgctg
ggttttccggccaacaacttcatggagcaggagccgggcagcaacgccgagatcgccagc
ttctgcagcgccaatttcgacgtgaccttcccgctgttttcgaagatctcggtggccggc
aatgccgtgcatccgctataccaggccctggtcgacgcccagccggtggccaccggcgaa
ggcccgctgcgcgaaaagctcaagtccatggacatcaaggtcaacccggcgccgggggtg
acctggaacttcgagaagttcctgattggccgcgatggtcgggtgctggcgcgcttcgcc
ccggacgtggggccggacgatccgcgtctgctccaggcggtggacgcggcgctggccgcg
ggctga

DBGET integrated database retrieval system