KEGG   Pseudoxanthomonas spadix: DSC_01165Help
Entry
DSC_01165         CDS       T01643                                 

Definition
exodeoxyribonuclease V subunit gamma
Orthology
K03583  
exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DSC_01165
Enzymes [BR:psd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DSC_01165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
38088..41549
Genome map
AA seq 1153 aa AA seqDB search
MSHHAPMQDARPDFRLYPANSLEVLAGLLAAELRQPVPGQSLLAPEVVLIPQVAMRRWLQ
ATLAAAHGVAANLLFLTPGEFVARALQANLGPAHDELDAASLHWRLYAALTDPAVLAQPA
LAALRAYLSGDDALKPWALAGELAGVFEKYQAWRRDWLLRWEAGADPHDPQALLWRQVAG
GQGHRARRVQAYLERFGGDTAALPVGLPRRVFAFATLNISPDVLRVLATQARVGTLHFYL
PTPAQGYWGDLQALAPRRRARGDDRAEPDLFDGHTGENPLLQAWGAAGRDFMAMLGGYEV
VHPRAEIEVYADPIASGQRPLAQGGLGDSLLRRMQSDLFRRVRPAVPAPLPALDRTDPSL
QVHASHTRLRELQVLHDQLRGLLEDPRFDPPLQPRQIAVLAPDIDPYVPYLEAVFGGSKP
GSESSFGQKLDSDPGFDPGFARIGYALADTSPLAGEPLAEVFVRLLGLPVSRFGLNETLD
LLASPPLAEAAGLDAAAFERLHGWLQAAGARWGLDAEHRARHAAPRDDAYTWQFALDRLL
LGHASGSEQDIAGLAPWPALEGSALSALDALIRLLRVLSRAQQALAEAMPPQAWRERLLG
LLDALLPQPPSAPGTQRALDRLRKLIDAFASAAQRAGFDAPLPAEVVRAHFAGVLAEADT
RAPLLTGGVSIGRMVPMRLLPFRVICLLGMNDGDFPRRDPAAGLNRLTAQLGTDQRRYGD
RSTREDDRFLFLQLFASAQDVFYVSYLGADPRDGSVREPSVLVSELIAAAADYHADPGQA
AAAMTVRHALQPFAPAAFGADGDPRQFSYRGQWQPGAGRLGGRRTRLGPWCDAALPAGDA
LETRVSIDALKRLLIAPAEQFLSQRLGLRLAEQIETGEDLEPLLMPGAGLEKHALQQAVF
AALLEDRQAGLAARLRARALLPSGALGRRALEGLLEQTQPYAQAFRHWRGTAQPEARLLE
VDLDGLVLHGRLGELYSHGLARMRLGPVSGVSAIRDGLDWLLASAAGLPQPLVQFDDRGD
AGAGPFLREPLDAAQARLVLRMLLQLRADGLQSPLPFAPYSGWEYFNAQTAEQALRRAAG
KWRGGERQWAEGSANSYQLALRGRDPFADPRTLQQFAHLSFTIYQAVTRGVIHEGFDDGR
SFVAEADEAQEDA
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatcatgcgccgatgcaggacgcgcgcccggatttccgcctttatcccgccaat
tcgctcgaggtgctggccggcctgctggcggccgaactgcgccagccggtgccgggccaa
tcgctcctggcgccggaggtggtgctgatcccgcaggtggcgatgcgccgctggctgcag
gccaccctggccgccgcccatggggtggccgccaacctgttgttcctgacccccggcgaa
ttcgtcgcccgcgcgctgcaagccaatctgggccctgcccatgacgaactggacgcggcc
agcctgcactggcgcctgtatgcggcgctgaccgacccggccgtgctggcccagccggcg
ctggccgcgctgcgcgcgtacctgtccggcgacgatgcgctcaaaccctgggcgctggcc
ggggaactggccggggtgttcgagaaataccaggcctggcgccgcgactggctgctgcgc
tgggaggccggcgccgatccgcacgatccgcaggcgctgctgtggcggcaggtggccggc
ggccagggccaccgcgcgcggcgcgtccaggcgtacctggagcgcttcggtggcgacacg
gccgccttgccggtgggcctgcccaggcgggtgttcgccttcgccacgctcaacatctcg
ccggacgtgctgcgggtgctggcgacccaggcgcgggtgggcaccctgcacttctacctg
cccaccccggcacagggctactggggcgacctgcaggcgctggcgccgcgccggcgcgcg
cgcggcgatgaccgcgcagagccggacctgttcgacggccacaccggcgaaaacccgctg
ctgcaggcctggggcgcggccgggcgcgacttcatggcgatgctcggtggctacgaagtg
gtccatccgcgcgccgagatcgaggtctacgccgacccgatcgcctccggccagcgcccg
ctggcccagggcggcctgggtgacagcctgctgcggcggatgcagagcgacctgttccgg
cgcgtgcgaccggccgtgccggcgccgctgccggcgctggaccgcaccgatcccagcctg
caggtccacgccagccacacccgcctgcgcgagctgcaggtgctgcacgaccagctgcgc
ggcctgctcgaggacccgcgcttcgatccgccgctgcagccgcgccagatcgcggtgctg
gcgccggacatcgacccctacgtgccgtatctggaagcggtgttcggcggatcaaaaccg
gggtcagagtcgagtttcgggcagaaactcgactctgaccccggttttgaccccggtttt
gcacgcattggctacgccctggccgacaccagtccgctggccggcgagccgctggccgag
gtgttcgtgcgcctgcttggcctgccggtctcgcgcttcggcctgaacgaaaccctggac
ctgctggccagcccgccgctggccgaagccgccggactggatgcggccgccttcgagcgc
ctgcatggctggctgcaggccgccggcgcgcgctggggcctggatgccgagcatcgcgcc
cggcacgccgcgccgcgcgatgacgcctacacctggcagttcgcgctggatcggttgctg
ctgggccatgccagcggcagcgagcaggacatcgccgggctcgccccgtggccggcgctg
gaaggcagcgcgctgtcggcgctggatgcgctgatccggctgctgcgggtgctgtcgcgg
gcgcagcaggcactggccgaggcgatgccgccgcaggcctggcgcgaacgcctgctcggc
ctgctcgatgcgctgctgccgcaaccgccctcggcgccgggcacgcagcgcgcattggac
cgcctgcgcaagctgatcgacgccttcgccagtgccgcccagcgcgccggcttcgatgcg
ccgctgccggccgaggtggtgcgtgcgcattttgccggcgtgctggccgaggccgacacc
cgcgcgccgctgctcaccggcggggtcagcattggccgcatggtgccgatgcggttgttg
ccgttccgggtgatctgcctgctggggatgaacgatggcgacttcccgcgccgcgatccg
gccgctgggctcaaccggctcaccgcccagctgggcaccgaccagcgccgttacggcgac
cgctccacgcgcgaggacgaccgcttcctgttcctgcagctgttcgcctcggcgcaggat
gtgttctacgtcagctacctgggcgccgacccgcgcgatggcagcgtgcgcgagccgtcg
gtgctggtcagcgagctgatcgccgcggcggcggactatcacgccgatccgggacaggcc
gccgcggcgatgaccgtgcgccatgcgctgcagccgttcgcgccggccgcgttcggcgcc
gatggcgacccgcgccagttcagctaccgcggccagtggcagccgggcgccgggcgcctg
ggcggcaggcggacaaggctggggccgtggtgcgatgcggcgctgcccgcaggcgatgcg
ctggagacgcgggtctcgatcgacgcgctcaagcgcttgctgatcgcaccggccgaacag
ttcctgagccagcgcctgggcctgcgcctggccgagcagatcgaaaccggcgaagacctc
gagccgctgctgatgcccggcgccgggctggagaaacatgcgctgcagcaggccgtcttt
gcggccctgctggaggaccggcaagccggcctggccgcgcgcctgcgcgcccgcgcgctg
ctgccctccggcgccctgggccgacgtgcgctggaaggcctgctggaacagacccaaccc
tacgcgcaggcattcaggcactggcgtggcaccgcccagcccgaggcgcgcctgctggaa
gtggacctggatggcctggtcctgcatggccgactcggcgagctgtattcgcatggcctg
gcgcgcatgcgcctgggcccggtgagcggcgtcagcgcgatccgcgacggcctggactgg
ctgctggccagcgccgccgggttgccgcagccgctggtgcagttcgacgatcgtggcgat
gcaggcgcaggtccgttcctgcgcgagccgctcgatgccgcgcaggcgcgcctggtgctg
cgcatgctgctgcagttgcgcgccgatggcctgcagtcgccgctgccgttcgccccctac
agcggctgggagtacttcaacgcccagaccgccgaacaggccctcagacgtgctgccggc
aaatggcgcggcggcgagcgccagtgggccgagggcagtgccaacagctaccagctcgcc
ctgcgcggccgcgatccgtttgccgatccccgcaccctgcagcagttcgcccacctcagc
ttcaccatctaccaggcggtgacgcgcggggtgatccatgaaggattcgacgatggccgc
agctttgtcgccgaagccgatgaagcacaggaggacgcatga

DBGET integrated database retrieval system