KEGG   Pseudoxanthomonas spadix: DSC_01875Help
Entry
DSC_01875         CDS       T01643                                 

Definition
(GenBank) strX protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00521  Streptomycin biosynthesis
psd00523  Polyketide sugar unit biosynthesis
psd01130  Biosynthesis of antibiotics
Module
psd_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    DSC_01875
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DSC_01875
Enzymes [BR:psd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     DSC_01875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AER55028
UniProt: G7UUU9
Position
complement(196286..196849)
Genome map
AA seq 187 aa AA seqDB search
MKFHQTPLKGAYVIEPEKRGDERGWFARIFCEKEMAAAGLVERFVQVNNSYNAQAGTLRG
MHYQLPPAPEVKIVRCVRGALWDAIVDLRPDSPTYLKWHGVELTAENRLAYYVPRGFAHG
FVTLEPDTEALYLASAFYEPSAERGLRWNDPAIGVQWPAVGTIISDKDAAWPDFDPGYHG
VEHLRGL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccaccagaccccgctcaagggcgcctatgtgatcgagccggaaaaacgcggc
gacgagcggggctggttcgcgcgcatattctgcgagaaggagatggctgccgccggcctg
gtcgagcgcttcgtccaggtcaacaactcctacaacgcgcaggccggcacgctgcgtggc
atgcactaccagctgccgccggcgccggaggtcaagatcgtgcgctgcgtgcgcggcgcg
ctgtgggatgccatcgtcgacctgcgcccggattcgcccacctacctgaaatggcacggt
gtggaactgaccgcggagaaccgcctggcctattacgtgccgcgcggttttgcccatggc
tttgtgaccctggagccggataccgaggcgttgtacctggccagtgccttctacgaaccc
agcgccgaacgtggcctgcgctggaacgaccctgcgatcggcgtgcaatggccggccgtg
ggcacgatcatttccgacaaggacgccgcgtggccggatttcgatccgggctaccacggc
gtcgaacacctgcgcggcctgtag

DBGET integrated database retrieval system