KEGG   Pseudoxanthomonas spadix: DSC_02090Help
Entry
DSC_02090         CDS       T01643                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00071  Fatty acid degradation
psd00072  Synthesis and degradation of ketone bodies
psd00280  Valine, leucine and isoleucine degradation
psd00310  Lysine degradation
psd00362  Benzoate degradation
psd00380  Tryptophan metabolism
psd00620  Pyruvate metabolism
psd00630  Glyoxylate and dicarboxylate metabolism
psd00640  Propanoate metabolism
psd00650  Butanoate metabolism
psd00900  Terpenoid backbone biosynthesis
psd01100  Metabolic pathways
psd01110  Biosynthesis of secondary metabolites
psd01120  Microbial metabolism in diverse environments
psd01130  Biosynthesis of antibiotics
psd01200  Carbon metabolism
psd01212  Fatty acid metabolism
psd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DSC_02090
   00630 Glyoxylate and dicarboxylate metabolism
    DSC_02090
   00640 Propanoate metabolism
    DSC_02090
   00650 Butanoate metabolism
    DSC_02090
  Lipid metabolism
   00071 Fatty acid degradation
    DSC_02090
   00072 Synthesis and degradation of ketone bodies
    DSC_02090
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DSC_02090
   00310 Lysine degradation
    DSC_02090
   00380 Tryptophan metabolism
    DSC_02090
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DSC_02090
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DSC_02090
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DSC_02090
Enzymes [BR:psd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DSC_02090
Exosome [BR:psd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DSC_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AER55071
UniProt: G7UUZ2
Position
240715..241917
Genome map
AA seq 400 aa AA seqDB search
MGNLGMSVRTLGALVERYGLHGQVLGEVAMGAVIKHPSDWNLGREAALSSGLSPLTPGIT
LQRACGTSLDTIAYIGNRIALGQIESGIGGGSDSTSEVPIVYAKKLRARLLAANRARTPR
DKARALRQGFRVSELRPEFPGVGEPRTGKSMGEHCEDMAKEWNISRDSQDEWAVSSHHKL
AAAYERGFFEDLIAPFRGVSRDNILRPDTSLEKLATLKPAFDKASGRGTLTAANSTPLTD
GAAAVLLASDDWAAAHGHVPLAYLRDVQSAAVDFVHGEGLLMAPTIAVPQMLARHGLGLQ
DFDIYEIHEAFAAQVLCTLRAWESEDYCTHRLGLPGPMGRIDPARINPNGSSLATGHPFA
ATGARIIATVAKELAQRGGGRALVSICTAGGMGVVAIVER
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaacctgggcatgtcggtgcgcacgctgggggcgctggttgagcgctacggcctg
cacgggcaggtcctgggcgaggtggcgatgggcgcggtgatcaagcaccccagcgactgg
aacctgggccgcgaggcggcgctgtcctcgggcctgtcgccgctcacgcccggcatcacc
ctgcagcgcgcctgcggcaccagcctggataccatcgcctacatcggcaaccggatcgcc
ctgggccagatcgagtcgggcatcggcggcggctcggattccacctccgaggtgccgatc
gtctatgccaagaagctgcgcgcgcggctgttggccgccaaccgcgccaggacgccccgg
gacaaggcccgcgcgctgcgccagggcttcagggtctccgagctcaggcccgagttcccc
ggcgtgggcgaaccgcgcaccggcaagtcgatgggcgagcactgcgaggacatggccaag
gaatggaacatctcgcgcgattcgcaggacgagtgggcggtgtcctcgcaccacaagctg
gccgcggcctatgagcgcggtttcttcgaggacctgatcgcaccgttccgcggggtcagc
cgcgacaacatcctgcgcccggacacctcgctggaaaagctggccacgctcaagcccgcg
ttcgacaaggcgtcgggccgcggcaccctgaccgcggccaattccacgccgctgaccgat
ggcgccgccgcggtgctgctggccagcgacgactgggccgccgcgcacggccacgtgccg
ctggcctacctgcgcgatgtgcagagcgcggcggtggatttcgtccacggcgagggcctg
ctgatggcgcccaccatcgccgtgccgcagatgctggcccggcatggactgggcctgcag
gacttcgacatctacgagatccacgaggcgtttgccgcgcaagtgctgtgcacgctgcgt
gcgtgggagagcgaggactactgcacccatcggctggggctgcccggaccgatggggcgc
atcgatccggccaggatcaaccccaacgggtcctcgctggccaccggccatcccttcgcc
gccaccggcgcgcggatcatcgccacggtggccaaggaactggcccagcgcggcggtggg
cgcgcgctggtgtcgatctgcaccgccggcggcatgggcgtggtggccatcgtcgaacgc
tga

DBGET integrated database retrieval system