KEGG   Pseudoxanthomonas spadix: DSC_02250Help
Entry
DSC_02250         CDS       T01643                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DSC_02250 (folE)
Enzymes [BR:psd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     DSC_02250 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
276181..276786
Genome map
AA seq 201 aa AA seqDB search
MSDSDNTRGGVSRDQAEDAVRTLLRWAGEDPAREGLLDTPKRVAKAYGDWFSGYRSDPHE
YLARTFEEVAGYDELIVLRDIEYESHCEHHMAPIIGRVHVGYLPNGKVVGISKLARVVDA
YARRFQVQEKMTAQIAQCIQDVLAPCGVGVVVEGAHECMSTRGVHKRGVSMVTSKMLGQF
RKDARTRAEFLRFIEVGSARR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattccgacaacacccgcggcggcgtcagccgcgaccaggccgaggacgcggtg
cgcaccctgctgcgctgggccggcgaggacccggcccgcgaaggcctgctcgatacgccc
aagcgggtggccaaggcctatggcgactggttcagtggctaccgcagtgacccgcatgag
tacctggcccggaccttcgaggaagtggccggctacgacgagctgatcgtgctgcgcgac
atcgagtatgaaagccattgcgagcatcacatggcgccgatcatcggcagggtccacgtc
ggctatctgcccaacggcaaggtggtgggcatcagcaagctggcgcgcgtggtggatgcc
tacgcccgccgcttccaggtccaggaaaagatgaccgcgcagatcgcccagtgcatccag
gacgtgctggccccatgcggggtgggcgtggtggtcgaaggcgcgcacgagtgcatgagc
acccgcggtgtgcacaagcgcggggtcagcatggtcacctccaagatgctgggccagttc
cgcaaggacgcgcgcacccgcgccgagttcctgcgcttcatcgaagtcggcagcgccagg
cgctga

DBGET integrated database retrieval system