KEGG   Pseudoxanthomonas spadix: DSC_02250Help
Entry
DSC_02250         CDS       T01643                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00790  Folate biosynthesis
psd01100  Metabolic pathways
Module
psd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DSC_02250 (folE)
Enzymes [BR:psd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     DSC_02250 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF XendoU
Motif
Other DBs
NCBI-ProteinID: AER55103
UniProt: G7UV24
Position
276181..276786
Genome map
AA seq 201 aa AA seqDB search
MSDSDNTRGGVSRDQAEDAVRTLLRWAGEDPAREGLLDTPKRVAKAYGDWFSGYRSDPHE
YLARTFEEVAGYDELIVLRDIEYESHCEHHMAPIIGRVHVGYLPNGKVVGISKLARVVDA
YARRFQVQEKMTAQIAQCIQDVLAPCGVGVVVEGAHECMSTRGVHKRGVSMVTSKMLGQF
RKDARTRAEFLRFIEVGSARR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattccgacaacacccgcggcggcgtcagccgcgaccaggccgaggacgcggtg
cgcaccctgctgcgctgggccggcgaggacccggcccgcgaaggcctgctcgatacgccc
aagcgggtggccaaggcctatggcgactggttcagtggctaccgcagtgacccgcatgag
tacctggcccggaccttcgaggaagtggccggctacgacgagctgatcgtgctgcgcgac
atcgagtatgaaagccattgcgagcatcacatggcgccgatcatcggcagggtccacgtc
ggctatctgcccaacggcaaggtggtgggcatcagcaagctggcgcgcgtggtggatgcc
tacgcccgccgcttccaggtccaggaaaagatgaccgcgcagatcgcccagtgcatccag
gacgtgctggccccatgcggggtgggcgtggtggtcgaaggcgcgcacgagtgcatgagc
acccgcggtgtgcacaagcgcggggtcagcatggtcacctccaagatgctgggccagttc
cgcaaggacgcgcgcacccgcgccgagttcctgcgcttcatcgaagtcggcagcgccagg
cgctga

DBGET integrated database retrieval system