KEGG   Pseudoxanthomonas spadix: DSC_02270Help
Entry
DSC_02270         CDS       T01643                                 

Definition
transglycosylase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSC_02270
Enzymes [BR:psd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     DSC_02270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
279542..280402
Genome map
AA seq 286 aa AA seqDB search
MAHTLTESTLHGLPVLRIETPLCTAALSLHGGQLLSFVPAGAGEVLWVSPLATGAPAAIR
GGVPVCWPYFGRENQPSNVPQHGFARNTRWTLEAPREDADGNLHLGLSLPGHPGTPLRLR
QILILGTGLQQALTTHNPSERTLSLTQALHSYFAVGDARQVHIEGLDGLDYDDKYSGQTL
TQRGHWHLSDPRDPGRSDRIYHAAGGHYVLHDPVLDRRLRITTTGSHAVVVWNPGQAGAQ
GMADVPDAHWPAFVCVEAANAARDVVRLAPGASHTLAQAVEVLPAA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcccacacgctgaccgaatccacgctgcatggcctgcctgtgctgcggatcgaaacg
ccgctgtgcactgctgcgctgtcgctgcacggcggccagctgctctcgttcgtgccggcc
ggtgccggtgaggtgttgtgggtctcgccgctggccaccggcgcgccggcggcgatccgt
ggcggcgtgccggtgtgctggccgtatttcggcagggaaaaccagccgagcaacgtgccg
cagcatggcttcgcccgcaacacgcgctggacgctggaagcaccgcgcgaggacgcagat
ggcaacctgcatctgggcctgtcgctgcccgggcaccccggcacgccactgcgcctgcgc
cagatcctgatcctgggcaccggcctgcaacaggcgctgaccacgcacaacccgtcagag
cgcacgctgtccctcacccaggccttgcacagctacttcgccgtgggcgatgcccggcag
gtgcatatcgaaggcctggacgggctggactacgacgacaaatacagcggccagaccctg
acccagcgcggccactggcacctgtccgatccgcgcgatcccggccgcagcgaccgcatc
taccatgcggccggcggtcactatgtcctgcacgatccagtgctggaccggcgcctgcgc
atcaccaccaccggcagccatgccgtggtggtgtggaatcccggccaggccggtgcccag
ggcatggccgatgtgcccgatgcgcactggccggccttcgtctgcgtggaagcggccaac
gccgcgcgcgatgtcgtccgcctggcgccaggtgccagccacaccctggcgcaggcggtg
gaagtgctgcccgcggcctga

DBGET integrated database retrieval system