KEGG   Pseudoxanthomonas spadix: DSC_02335Help
Entry
DSC_02335         CDS       T01643                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psd01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:psd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
297456..298247
Genome map
AA seq 263 aa AA seqDB search
MSDILDTILARKREEIAARGARVPLHELIARARDASPVRGFADALRRTIAGGDAGVIAEV
KKASPSKGVIRPDFNPAEIAVSYQFGGASCLSVLTDVDFFQGADAYLQQAREACTLPVLR
KDFTIDPYQVYEARVLGADCILLIVAALEDRQLVSLADLAMQLGMDVLVEVHDIDELERA
LQVPAPLLGINNRNLRTFEVSLHNTLEMKGAVPRDRILVTESGIATGDDVAMLRGQGVHA
FLVGETFMRAPEPGEALRQLFFA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcgacaccatcctggcccgcaagcgcgaggaaatcgccgcgcgcggc
gcgcgggtcccgctgcacgagctgatcgcgcgcgcgcgcgatgcttcgccggtgcgtggc
tttgccgatgcgttgcgtcgcacgatcgccggcggcgatgccggggtgatcgccgaggtc
aagaaggccagcccctccaagggcgtgatccggcccgacttcaatccggccgagatcgcg
gtgagctaccaattcggcggcgcctcgtgcctgtcggtgctgaccgacgtggatttcttc
cagggcgccgatgcctacctgcagcaggcgcgcgaggcctgcaccctgccggtgctgcgc
aaggacttcaccatcgacccctaccaggtctacgaagcgcgcgtgctgggcgccgactgc
atcctgctgatcgtggccgcgctggaggaccggcagctggtgtcgctggccgacctggcc
atgcagctgggcatggacgtgctggtggaagtgcacgacatcgacgagctggagcgcgcg
ctgcaggtgccggcgccgctgctgggcatcaacaaccgcaacctgcgcaccttcgaggtg
tcgctgcacaacaccctggagatgaagggcgcggtgccgcgcgaccggatcctggtgacc
gagagcggcatcgccaccggcgatgacgtggcgatgctacgcgggcagggggtacacgcg
ttcctggtcggcgaaaccttcatgcgcgcgcccgagccgggcgaggcgctgcgccagctg
ttcttcgcatga

DBGET integrated database retrieval system