KEGG   Pseudoxanthomonas spadix: DSC_02530Help
Entry
DSC_02530         CDS       T01643                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    DSC_02530
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DSC_02530
Enzymes [BR:psd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     DSC_02530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
335069..335626
Genome map
AA seq 185 aa AA seqDB search
MKVIETSLPGCRIIEPAVFGDERGFFMETWNAARYGELGLPDRFVQSNVSSSTKGVLRGL
HYQWPNPQGKLVTVLEGEVYDVAVDIRRGSPQFGQWTAVLLSAQNKRQFWIPEGFAHGFA
VLSERALFSYMCTDVYDKAADAGVRWDDPAIGIDWPVANPSLSEKDAGAPLLAQVAQERL
PVLVA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcatcgagacgtccctgccgggctgcaggatcatcgaaccggcggtgttcggc
gatgagcgcgggttcttcatggaaacctggaacgccgcgcgctatggcgagcttggcctg
cccgaccgcttcgtccagagcaacgtctcgtcctcgaccaagggcgtgctgcgcggcctg
cattaccagtggcccaacccgcagggcaagctggtcaccgtgctggaaggggaggtctac
gacgtggcggtggacatccggcgtggctcgccgcagttcggccagtggaccgcggtgctg
ctgagcgcgcagaacaagcgccagttctggatccccgaaggcttcgcccacgggtttgcg
gtgctgtccgagcgcgcgctcttcagctacatgtgtaccgatgtctatgacaaggccgcc
gatgccggggtgcgctgggacgatccggcgatcggcatcgactggccggtggccaatccc
agcctgtcggagaaggatgccggggcgccgctgctggcgcaggttgcgcaggagcgtctg
ccggtgctggtcgcatga

DBGET integrated database retrieval system