KEGG   Pseudoxanthomonas spadix: DSC_02545Help
Entry
DSC_02545         CDS       T01643                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00010  Glycolysis / Gluconeogenesis
psd00030  Pentose phosphate pathway
psd00051  Fructose and mannose metabolism
psd00052  Galactose metabolism
psd00230  Purine metabolism
psd00500  Starch and sucrose metabolism
psd00520  Amino sugar and nucleotide sugar metabolism
psd00521  Streptomycin biosynthesis
psd01100  Metabolic pathways
psd01110  Biosynthesis of secondary metabolites
psd01120  Microbial metabolism in diverse environments
psd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSC_02545
   00030 Pentose phosphate pathway
    DSC_02545
   00051 Fructose and mannose metabolism
    DSC_02545
   00052 Galactose metabolism
    DSC_02545
   00500 Starch and sucrose metabolism
    DSC_02545
   00520 Amino sugar and nucleotide sugar metabolism
    DSC_02545
  Nucleotide metabolism
   00230 Purine metabolism
    DSC_02545
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DSC_02545
Enzymes [BR:psd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     DSC_02545
    5.4.2.8  phosphomannomutase
     DSC_02545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AER55162
UniProt: G7UVP5
Position
complement(338431..339777)
Genome map
AA seq 448 aa AA seqDB search
MALPAFKAYDIRGRVPDELDEDLARRIGVALADMLGAGPVVLGHDVRLTSPALQDALSVG
LRCKGREVIDIGLCGTEEVYFQTDHLKAAGGVMVTASHNPMDYNGMKLVRENARPISSDT
GLFEIRDRAEADRTPAGEPIGQEAHRPDKTAYIQHLLSYIKPGTLKPLKIVTNAGNGGAG
AIIDLLAPHLPLQFIRIYHEPDGHFPNGIPNPLLPENRAATAEAVQQHGADFGIAWDGDF
DRCFFFDEKGQFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEMVEQAGGIPVLCK
SGHAFIKEKMRAENAVYGGEMSAHHYFRQFAFADSGMIPWLLIAELVSTSGRSLGDWVED
RVAKFPCSGEINFKVDDAKAAVQRVMEHYAALNPQLDHTDGISADFGQWRFNIRSSNTEP
LLRLNVETRADAALLKQKTDEISALLQG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcccgcattcaaggcctacgacatccgtggccgcgtccccgacgaactggac
gaggacctggcccgccgcatcggcgtggccctggccgacatgctgggcgccgggccggtg
gtgctgggccacgatgtgcgcctgaccagccccgccctgcaggacgcgctgtcggtcggc
ctgcgctgcaaaggccgcgaggtcatcgacatcggcctgtgcggcaccgaggaagtctat
ttccagaccgatcacctcaaggccgccggcggggtgatggtcaccgccagccacaatccg
atggactacaacgggatgaagctggtgcgcgagaacgcgcgcccgatcagctcggacacc
ggcctgttcgagatccgcgaccgggccgaggccgacaggacccctgccggcgaaccgatc
ggccaggaagcgcaccgcccggacaagaccgcctacatccagcacctgctcagctacatc
aagcccggcacgctcaagccgctcaagatcgtgaccaatgccggcaacggcggcgccggc
gcgatcatcgacctgctggccccgcacctgccgctgcaattcatccgcatctaccacgag
ccggacggccatttccccaacggcatccccaatcccctgttgccggaaaaccgcgccgcc
accgccgaggcggtccagcaacatggcgcggatttcggcatcgcctgggacggcgacttc
gaccgctgcttcttcttcgacgagaagggccagttcatcgagggctattacctggtcggc
ctgctggcccaggcgatcctggccaagcagcccggcggcaaggtcgtgcacgatccgcgc
ctgacctggaacaccgtggagatggtcgagcaggccggcggcatcccggtgctgtgcaag
agcggccacgccttcatcaaggagaagatgcgcgccgaaaacgccgtgtacggcggcgaa
atgagcgcccaccactacttccgccagttcgccttcgccgactcgggcatgatcccgtgg
ctgctgatcgccgaactggtcagcacctccggccgctcgctgggcgactgggtggaagac
cgggtggccaagttcccgtgcagcggcgagatcaacttcaaggtcgacgatgccaaggcg
gccgtgcagcgggtcatggagcactatgctgccctcaatcctcagctggaccacaccgac
gggatcagcgccgatttcggccagtggcgcttcaacatccgcagctccaacaccgagccg
ttgctgcgcctgaacgtggaaacccgcgccgatgcagcgctgctgaagcagaagaccgac
gagatttcagcgctgctgcagggctga

DBGET integrated database retrieval system