KEGG   Pseudoxanthomonas spadix: DSC_02670Help
Entry
DSC_02670         CDS       T01643                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psd  Pseudoxanthomonas spadix
Brite
Enzymes [BR:psd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     DSC_02670
Secretion system [BR:psd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   DSC_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
365090..365923
Genome map
AA seq 277 aa AA seqDB search
MRRFLPFFLLAGLSLGACAQQPQNAAARPAPARPAAAPTAPAAVASNDPADAKVRAALRQ
LNPQVEVDYIGKAPLPGFREVIAAGQLVYVSEDGKYLLQGSLVDIGQRKDLMQGSPALAG
YRQNLLKSVKDSDKIVFAPANPRYTVNVFTDIQCGYCRKLHSQIADYNKLGIAVEYLAWP
RMGLGSQDHKDMISVWCAADRKKALTEAKQSGRVAARDCTNPVNMEYDIGQRLGISGTPA
VFAPDGSQIGGYLPPAEMRAALDKLAAAGAGKPSGIP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtttcctccccttcttcctgctggccggcctgagcctgggggcctgcgcccag
cagccgcagaacgccgccgcccggcccgcgccggccaggcctgccgccgcgcccaccgcg
cccgctgccgtcgccagcaacgacccggccgatgccaaggtgcgcgccgcgctcaggcag
ctcaatccgcaagtcgaggtggactacatcggcaaggcgccgctgccgggcttccgcgag
gtcatcgccgccggccagctggtgtacgtcagcgaggacggcaagtacctgctgcagggc
agcctggtcgatatcggccagcgcaaggacctgatgcagggcagcccggcgctggccggg
taccgccagaacctgctcaagtcggtcaaggacagcgacaagatcgtgtttgccccggcc
aaccccaggtacaccgtcaatgtcttcaccgacatccagtgcggctactgccgcaagctg
cacagccagattgccgactacaacaagctgggcatcgcggtggaatacctggcctggccg
cgcatgggcctgggcagccaggaccacaaggacatgatctcggtctggtgcgccgccgac
cgcaagaaggccttgaccgaggccaagcagagtggccgggttgccgcgcgcgactgcacc
aacccggtgaacatggaatacgacatcggccagcgcctgggcatcagcgggaccccggcg
gtgttcgctccggacggcagccagatcggcggttacctgcccccggccgagatgcgcgcg
gccctggacaagctggccgcggccggtgccggcaagccgtcgggcattccctga

DBGET integrated database retrieval system