KEGG   Pseudoxanthomonas spadix: DSC_02830Help
Entry
DSC_02830         CDS       T01643                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DSC_02830
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSC_02830
  Lipid metabolism
   00071 Fatty acid degradation
    DSC_02830
  Amino acid metabolism
   00350 Tyrosine metabolism
    DSC_02830
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DSC_02830
   00626 Naphthalene degradation
    DSC_02830
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DSC_02830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(398706..399680)
Genome map
AA seq 324 aa AA seqDB search
MLLRHPGQPLEWAELPDPVPGPGQVLIRVGACGVCRTDLHVVDGDLRQPALPLIPGHEIV
GRIVARGPGVESLAIGQRVGVGWLGHTCQHCDYCQDDRENLCDHPGFTGYTRNGGFAELT
LAEARFTYPLPKAGDDAQMAPLLCAGLIGWRALVIAGQGQRLGLYGFGAAAHLIVQVARW
QGRQVHAFTRPGDQAAQAFALSLGASSAGPSDQPSPQLLDAAIIFAPVGSLVPTALASVR
KGGRVVCAGIYMSDIPSFPYELLWEERQLVSVANLTRRDAHQFLALAPKVGLHASVVRYP
LAQANQALSDLREGRLSGAAVLVP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcgccatcccgggcaaccgctggaatgggccgaactgcccgatccggtccct
gggccgggccaggtcctgatccgggtcggcgcctgtggtgtctgccgcaccgacctgcat
gtggtcgacggtgacttgcgacagcccgccctgccgctgattcccgggcacgagatcgtc
ggccggatcgtggcgcgcggcccgggtgtggaatccctggcgatcggccagcgcgtgggg
gtcggctggctcggccatacctgccagcactgcgactactgccaggacgaccgcgaaaac
ctctgcgaccatcccggcttcaccggctacacccgcaacggcggtttcgccgaactgacg
ctggccgaggcccgcttcacctatccgctgcccaaggccggcgacgacgcgcagatggca
ccgctgctgtgcgccgggctgatcggctggcgcgcgctggtgatcgccggccaaggccag
cgcctgggcctgtacggcttcggcgccgccgcgcacctgatcgtgcaggtggcgcgctgg
cagggccgccaggtgcatgccttcacccgcccgggcgaccaggcggcgcaggccttcgcc
ctgtcgctaggcgccagctcggccgggccctcggaccagccctcgccgcagctgctggac
gcggcgatcatcttcgcgccggtcggaagcctggtccccaccgccctggcctcggtgcgc
aagggcggccgggtggtgtgcgcgggcatctacatgagcgacatcccgtcctttccgtat
gaactgctgtgggaagagcggcaactggtgtcggtggccaacctgacccgccgtgacgcg
caccagttcctggcgctggcgcccaaggtcggcctgcacgccagcgtggtgcgctacccg
ctggcccaggccaatcaggcgctgtcggatctgcgcgaaggccggctgagcggggcagcg
gtgctggtgccgtga

DBGET integrated database retrieval system