KEGG   Pseudoxanthomonas spadix: DSC_02860Help
Entry
DSC_02860         CDS       T01643                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:psd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:psd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405027..406538
Genome map
AA seq 503 aa AA seqDB search
MSRAMALSALLPDVPAIPAGVVVHGLTQDSRSVRAGDAFVAIGPVDNSASSWHGLGFVEQ
ARARGAVAILFEPPAPESLPAPADAIAVPGLRARLGALADTFYGHPSQQMTMVGVTGTNG
KTSTVQLLSQAWHLRGTVSGSIGTLGAGLYGQLRPTGFTTPLVLELHALLAQLHDAGAQA
IAMEVSSHALAQTRVDGVHFDVAVFTNLSRDHLDYHGDMERYGAAKARLFQRPGLKAAVI
NLDDGFGATLAGTLAGDVQLVGVSAHGAAAARVQAREVVLDNAGIGFDLVIGATTHPVRS
PLLGRFNVDNLLAVAGVLLATGDAPAQIARTLTQLQPIHGRMNRLGGVDGQPLVVIDYAH
TPDALAQALTSLRAHVAGRLICVFGCGGQRDAGKRPQMARIAQDHADVVIVTDDNPRHED
GEAIVADILAGFSDDAVYAVQRDRAAAIARAIGQARAGDIVLIAGKGHEPYQDIGGVKQA
FDDTVQARIALQARAPDPAQVRR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgccatggccctgtctgcgctgctgccggacgtgcccgccatcccggcgggg
gtggtcgtgcacggcctgacccaggacagccgcagcgtgcgcgccggtgatgccttcgtg
gcgatcggcccggtcgacaacagcgcctccagctggcacggactgggctttgtcgagcag
gcgcgtgcgcgcggcgcagtggcgatcctgttcgaaccgccggccccggagtcgctgccc
gcaccagccgatgcgatcgccgtgcccggcctgcgtgcgcgcctgggggcgctggccgac
accttctacggccacccctcgcagcagatgacgatggtcggtgtcaccggcaccaacggc
aagacctccaccgtgcagctgctgagccaggcctggcacctgcgcggcaccgtgagcggc
agcatcggcacgttgggcgcgggcctgtacggccagctgcggccgaccggcttcaccaca
ccgctggtgctcgagctgcatgcgctgctggcccagttgcacgatgccggcgcacaggcg
atcgcgatggaagtcagctcgcacgcgctggcccagacccgcgtggacggcgtgcatttc
gacgtggcggtgttcaccaacctcagccgcgatcacctggactaccacggcgacatggag
cgctacggcgcggccaaggcgcggctgttccagcgcccggggctgaaggcggcggtgatc
aacctggacgatggcttcggcgcgaccctggcgggcacgctggccggggacgtgcagctg
gtcggggtcagcgcccatggcgcggccgctgcccgcgtgcaggcgcgcgaggtggtgctg
gacaacgccgggatcggtttcgacctggtgatcggcgccaccacccatccggtgcgctcg
ccactgctgggccgtttcaacgtcgacaacctgctggccgtggccggcgtgctgctggcc
accggcgatgcgccggcgcagatcgcgcgcacgcttacgcagctgcagccgatccacggc
cgcatgaaccgcctcggcggcgtcgatggccagccgctggtggtgatcgactacgcgcat
acacccgacgcgctggcgcaggccctgaccagcctgcgcgcgcacgtggccggccggctg
atctgcgtgttcggctgcggtggccagcgcgatgccggcaagcgtccgcagatggccagg
atcgcgcaggaccatgccgatgtggtgatcgtcaccgacgacaatccgcgccacgaagac
ggcgaggcgatcgtggccgacatcctcgccggcttctccgacgatgcggtctacgccgtg
cagcgcgatcgcgccgcggccatcgcccgcgccatcggccaagccagggccggcgacatc
gtcctgatcgccggcaagggccacgagccctatcaggacatcggcggggtcaagcaggcc
ttcgatgacaccgtgcaggcccgcatcgccctgcaggcgcgcgcgccggaccctgcgcag
gtgcggcgatga

DBGET integrated database retrieval system