KEGG   Pseudoxanthomonas spadix: DSC_03570Help
Entry
DSC_03570         CDS       T01643                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00010  Glycolysis / Gluconeogenesis
psd00620  Pyruvate metabolism
psd00640  Propanoate metabolism
psd00680  Methane metabolism
psd01100  Metabolic pathways
psd01110  Biosynthesis of secondary metabolites
psd01120  Microbial metabolism in diverse environments
psd01130  Biosynthesis of antibiotics
psd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSC_03570
   00620 Pyruvate metabolism
    DSC_03570
   00640 Propanoate metabolism
    DSC_03570
  Energy metabolism
   00680 Methane metabolism
    DSC_03570
Enzymes [BR:psd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DSC_03570
Lipid biosynthesis proteins [BR:psd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DSC_03570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AER55367
UniProt: G7UND6
Position
complement(571707..573332)
Genome map
AA seq 541 aa AA seqDB search
MNTERRDYFEHVRQLPPAPPAGPVNAWIACCGAHLGQQREALCWVDLQRQVRRYTFEQLD
AWSAQFAHLLVARGLKPGDVVAGLLPRRLELLIVILGTWRAGCVYQPLFTAFGPKALEHR
LSSSGARLVVCSPDQRPKLDQVTAAPPVLTLEGEGDQDFWQALDGLPTTFAPVPLTGEDP
FMIMFTSGTVGAAKGLMVPLRGLEVMATYMREAVDLRADDVFWNIADPGWAYGLYYGVVG
PLALGHSITFHEGPFTVDSCYRTIAELGVTNLAGAPTAYRMLMAAGEAAAAPIKGQLRAV
SSAGEPLNPEVIRWFDKTLGTVIHDHYGQTETGMILCNHHGLAHPVRLGSAGYPLRGYRL
EVLDEAGQPQPVGKPGMLAVHIADSPALFFTGYLQTERQPFKDGWYLTGDTVERNQDGSI
AFVGRSDDVITSAGYRIGPFDVESCLLEHPEVIEAAVVGKPDPERTEVVKAYVVLREGAT
GSDALAEELAQYVKKRLSAHAYPREIAFVDELPKTPSGKIQRFLLRNQARAEAARAVPPA
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgaacgccgcgactatttcgaacacgtccgccagctgccgcccgcgccgccg
gccggtccggtcaacgcctggatcgcctgctgtggcgcccacctgggccaacagcgcgaa
gcattgtgctgggtggacctgcagcgccaggtgcgccgctacacctttgaacagctcgat
gcctggtcggcccagttcgcgcacctgctggtcgcgcgcgggctcaagcccggcgatgtg
gtcgccggcctgctgccgcgccggctggaactgctgatcgtgatcctgggcacctggcgg
gccggctgtgtgtaccagccgctgttcaccgccttcgggcccaaggcgctcgagcaccgc
ctgtcttccagcggcgccaggctggtggtgtgctcgccggaccagcgcccgaagctggac
caggtcaccgctgcgccgccggtgctcaccctggagggcgaaggcgaccaggacttctgg
caggcgctggacggcctgcccaccaccttcgcgccggtgccgctgaccggcgaagacccg
ttcatgatcatgttcacctccggtaccgtcggcgccgccaagggcctgatggtgccgctg
cgcggcctggaggtgatggccacctacatgcgcgaggcggtggacctgcgcgcggacgac
gtgttctggaacatcgccgatcccggctgggcctacggcctgtactacggcgtggtcggg
ccgctggcgctgggccattcgatcaccttccacgaaggcccgttcaccgtggacagctgc
tatcgcacgatcgccgagctgggcgtgaccaacctggccggcgcacccaccgcctaccgc
atgctgatggctgccggcgaggccgcggccgcgccgataaagggccagctgcgcgcggtc
agcagcgccggcgagccgctcaatcctgaagtcatccgctggttcgacaagaccctgggc
acggtgatccacgaccactacggccagaccgagaccggcatgatcctgtgcaaccaccat
gggctggctcatccggtgcggctgggcagcgccggctatccgctgcgcggttatcggctc
gaggtgctggacgaagccggccagccgcagccggtgggcaagcccggaatgctggccgtg
cacatcgccgattcgccggcgctgttcttcaccggctacctgcagaccgaacgccagccg
ttcaaggatggctggtacctcaccggcgacacggtcgagcgcaaccaggacggcagcatc
gccttcgtcggccgcagcgacgatgtgatcacctcggctggctaccggatcggtccgttc
gacgtggaaagctgcctgctggagcatcccgaggtcatcgaggccgccgtggtcggcaag
cccgacccggaacgcacggaggtagtgaaggcctacgtggtgctgcgcgaaggcgccacc
ggcagcgacgcgctggccgaggaactggcgcagtacgtgaagaagcgcctgtccgcccac
gcctacccgcgcgagatcgccttcgtcgacgaactgcccaagacccccagcggcaagatc
cagcggttcctgttgcgcaaccaggcccgggccgaagccgcacgggcggtcccgccggcg
gcgtga

DBGET integrated database retrieval system