KEGG   Pseudoxanthomonas spadix: DSC_03810Help
Entry
DSC_03810         CDS       T01643                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:psd00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(622143..623669)
Genome map
AA seq 508 aa AA seqDB search
MTGTADQTANAPPTLRARRLGLHSQHQAIAVMRTDCHVCRAEGLSSRSQVLLSAGGRQVL
AMLYQADGDLVAPGEAALSESAWERLGVAEGTPIKVSHAPSLDSLANVRRRIYGHRLDAA
ALQAVVEDVTAGRYTDVHLAAFLTASAALPLDEQETVDLTAAMVDVGDRLAWNVPVVVDK
HCIGGLPGNRTTPIVVAIVAANGLVMPKTSSRAITSPAGTADTMETLAPVDLDLATIQRV
VDQEGGCIAWGGAVHLSPADDIFVRVERELDVDTEGQLIASVLSKKIAAGSSHVVLDIPV
GPTAKVRTEEAARRLGDRLVAVAAHFGLAATCIRTDGSQPVGRGIGPALEAHDILAVLQN
RPDMPADLRNRAAVLAGAALEIGGAAEAGAGHALALATLADGRAWTKFQRICQAQGGMRE
PPRALHVRPLTAGRAGRIVQINNRKISQLAKLAGAPEAKAAGVTMDVMLGDEVASGQPLL
RLHADTVGELAYAMEYASRNPDIIEIAT
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgggactgccgaccagaccgccaatgcgccgccgaccctgcgcgcccggcgcctg
ggcctgcattcccagcaccaagcgatcgcggtcatgcgaaccgattgccatgtctgccgc
gccgaaggtctgagctcccgctcccaggtcctgctctcggcgggggggcgacaggtcctg
gcgatgctttatcaggccgatggcgatctggtggcgcccggcgaggcggcgctgtccgag
tccgcgtgggaacgcttgggcgtcgcggagggcacgcccatcaaggtctcccatgcgccg
agcctggactccctggcaaacgtgcgacgacgcatctatggccaccggctcgatgcggcc
gccctgcaggcggtcgtcgaggacgtcaccgcgggacgctacacggacgtgcacctggcc
gcattcctgaccgccagtgcggccctgccgctggatgagcaggagaccgtcgacctgacc
gcagcgatggtcgacgtcggggaccgcctggcgtggaacgtgccggtggtcgtggacaag
cactgcattggtggactgccgggcaaccggaccacgcctatcgtggtcgcgatcgtcgca
gccaacggtctggtgatgcccaagacgtcctcgcgcgccatcacctcgccggccggcacc
gcggacaccatggagacactggcacccgtcgatctcgacctggccacgatccagcgcgtg
gtggaccaggaaggcggctgcatcgcctggggcggcgccgtgcatctcagtcctgccgac
gacatcttcgtgcgggtggagcgggaactggacgtggacaccgaggggcagctgatcgcc
tccgtgctgtccaagaagatcgcggcagggtccagccacgtcgtgctcgacatcccggtc
ggaccgaccgccaaagtccgcaccgaggaagccgcacgccggctgggggatcggctggtc
gcggtcgccgcgcactttggcctggccgcgacgtgcatccgcaccgatggcagccaaccg
gttggccggggcatcggtcctgcgctcgaagcgcacgacattctcgccgtcctgcagaac
cggcccgatatgcccgccgatttgcggaaccgggccgccgtgctcgccggtgccgcgctc
gagatcggcggcgcggcagaggcgggagcaggccatgccctggccttggctaccttggcc
gacgggcgggcgtggacgaaattccagcgcatctgccaggcccagggaggcatgcgcgag
ccgcccagggccttgcacgtgcggcctctgaccgccgggcgtgcagggcgaatcgtccag
atcaacaaccgcaagatctcccagctcgccaagctggccggtgcgccggaggccaaggcc
gccggcgtgaccatggacgtcatgctcggggacgaagtcgccagcggacagccgctgctt
cggttgcacgccgacaccgtgggtgaactggcctatgccatggagtacgcgtcccggaac
ccggacatcatcgagatcgcgacttga

DBGET integrated database retrieval system