KEGG   Pseudoxanthomonas spadix: DSC_05340Help
Entry
DSC_05340         CDS       T01643                                 

Definition
sulfite synthesis pathway protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    DSC_05340
Enzymes [BR:psd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     DSC_05340
Transfer RNA biogenesis [BR:psd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    DSC_05340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961878..962672
Genome map
AA seq 264 aa AA seqDB search
MSRITADLHEAIIAIARDASAAIMEVYAEDFQVEHKADHSPLTRADLAAHRIIADGLSRL
TPELPLLSEEGASIPWGTRQDWHAYWLVDPLDGTREFVKRNGEFTVNIALIEGHQPVFGV
IMAPVTGTIWHAEAGRRALRRDGENDRELRTRHPAVAPLRVAASRSHRDPRTQAVLDRLP
GAQTVPLGSSLKFCHIAEGALDLYPRFGHTCEWDTAAGQCILEAAGGALLAPDGRAFRYN
RRESLLNGDFIALGDPSLPWRDWL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcaccgcggacctgcacgaggccatcattgccatcgcccgcgacgcctcg
gccgcgatcatggaagtctatgccgaggacttccaggtcgagcacaaggccgaccacagc
ccgctcacccgcgccgacctggccgcgcaccggatcattgccgatggcctgtcccggctc
acgcccgagctgccgctgctcagcgaggagggcgccagcatcccgtggggcacgcgccag
gactggcacgcctactggctggtcgatccgctggacggcacccgcgagttcgtcaagcgc
aatggcgagttcaccgtcaacatcgccctgatcgaaggccaccagccggtgttcggggtg
atcatggcgccggtgaccggcaccatctggcacgccgaagccggccgccgtgcgctgcgc
cgcgacggcgagaatgaccgcgagttgcgcacccgccatccggccgtggcgccactgcgg
gtggccgccagccgttcgcaccgcgatccgcgcacccaggccgtgctcgaccgcctgcca
ggtgcccagaccgtgccgctgggctcctcgctcaagttctgccacatcgcagaaggcgcg
ctggatctgtatccgcgcttcggccacacctgcgaatgggacaccgccgccggccagtgc
atcctggaggcagccggcggtgcgctgctggcaccggacgggcgcgcatttcgctacaac
cggcgcgagagcctgctcaacggcgatttcatcgccctgggcgacccctcgctgccgtgg
cgcgactggctgtag

DBGET integrated database retrieval system