KEGG   Pseudoxanthomonas spadix: DSC_05420Help
Entry
DSC_05420         CDS       T01643                                 

Definition
dihydrofolate reductase type III
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
psd  Pseudoxanthomonas spadix
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psd00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:psd00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974634..975131
Genome map
AA seq 165 aa AA seqDB search
MRISLIAALDRNHAIGRDNRLPWRLPDDLRRFKALTLGKPVLMGRKTAQSLGRALPGRLN
LVLTRSGQVPFEGMVAVASIEQAIAQAQAQSADELCVIGGGQVYAQLLARADALHLTRVD
TVVEGADAFFPAFDPHDWVVSARQRHPADPGHALAFEFIDYTREG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgcggatctcgctgatcgccgcgctggaccgcaaccacgccatcggccgcgacaaccgg
ctgccctggcgcctgcccgatgacctcaggcgcttcaaggcactcaccctgggcaagccg
gtgctgatgggacgcaagaccgcccagtcgctggggcgggcactgccggggcgcctgaac
ctggtgctcacgcgcagcggccaggtgccgttcgagggcatggtcgcggtggcctcgatc
gaacaggcgatcgcgcaggcgcaggcgcagtcagcggacgagctgtgcgtgatcggcggc
ggccaggtctacgcgcagttgctggcccgggccgatgcgctgcacctgacccgggtggac
accgtggtcgagggcgccgatgcgttcttcccggcattcgatccacacgactgggtggtg
agcgcgcgccagcggcatccggccgacccgggccacgcattggcgtttgaattcatcgac
tacacccgcgagggctga

DBGET integrated database retrieval system