KEGG   Pseudoxanthomonas spadix: DSC_05820Help
Entry
DSC_05820         CDS       T01643                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:psd00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:psd00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049181..1049966
Genome map
AA seq 261 aa AA seqDB search
MSGSLDGQVAVITGAASGIGKALAQALAQAGAQVAIADLNLPGAQAAAGEIQAAGGRALG
VAMDVTDEAAVNAGIAQVEQALGPVDILIANAGVQIVHPIQDFPFDAWKKLLAIHLDGAF
LTTKAVLPGMYARKRGTVIYMGSAHSHEASPLKSAYVTAKHGLLGLARTLAKEGGAHGVR
SHVVCPGFVRTPLVEKQIPEQAASLGISEEEVIQRVMLGNTVDGTFTTLEDVATTVLFLC
RFPSNALTGQSILVSHGWHMG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtccggttccctcgatggccaggtggccgtcatcaccggcgctgccagcggcatcggc
aaggccctggcccaggcgctggcgcaggccggcgcgcaggtggccatcgccgatctgaac
ctgccaggcgcgcaagctgcggcgggcgaaatccaggccgcaggtggccgcgcgctgggc
gtggcgatggacgtcaccgatgaggccgcggtcaacgccggcatcgcccaggtcgaacag
gcgcttggcccggtggacatcctcatcgccaatgccggcgtgcagatcgtccatccgatc
caggactttcccttcgatgcctggaaaaagctgctcgcgatccacctggatggtgcgttc
ctgaccaccaaggcggtgctgcctggcatgtatgcgcgcaaacgcggcacggtgatctac
atgggctcggcccattcgcacgaggcctcgccgctgaagtcggcctacgtcaccgccaag
cacgggctgctgggcctggcccgcaccctggccaaggaaggcggcgcgcatggcgtgcgc
agccacgtggtctgcccgggcttcgtgcgcacgccgctggtggaaaagcagatccccgaa
caggccgcaagcctggggatcagcgaagaggaggtgatccagcgggtgatgctgggcaac
accgtcgatggcaccttcaccacgctggaggacgtggccaccacggtgctgttcctgtgc
cggttccccagcaacgccctgaccggacagagcatcctggtcagccatggctggcacatg
ggttga

DBGET integrated database retrieval system