KEGG   Pseudoxanthomonas spadix: DSC_06005Help
Entry
DSC_06005         CDS       T01643                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DSC_06005
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DSC_06005
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DSC_06005
Enzymes [BR:psd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DSC_06005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095723..1097021
Genome map
AA seq 432 aa AA seqDB search
MNFISTRNASPAVSLSDAIAAGLAPDGGLYVPQAMPDARELQPGHSLAQTAATLLQPFLA
GDRLESQLAAICESAFDFPAPLLPLATPGDQVLELFHGPTAAFKDFGARFLAQCLTRLRG
ADARPLTILVATSGDTGAAVAAAFHRQPNLRVVVLYPDGRVSPRQAHQLGCFGDNITALR
VAGSFDDCQALVKRALSDASLQARAPLSSANSISLGRLLPQMSYYAHAALCHRAQTGNTL
NFVIPTGNLGNAMAAILARALGVPIGRIVLATNANRVLPDYFAGKDYAPQPSVATIANAM
DVGAPSNFERLRWLYHGDDAALRAAFTAASVEDDAIGLLIARRHRHFGEVFCPHTATAVK
VLEDLRNQGVEGDWAVAATAHPAKFEGVVEPLVGAVPVPPALNALLQRPAHADPIEPDYQ
ALVQHILATPAG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcatctccacccgcaacgcctcccccgccgtctccctgagcgatgccatcgcc
gccggccttgcgcccgatggcggcctgtacgtgccgcaggccatgccggacgcgcgcgaa
ctgcagcccggccatagcctggcgcagaccgccgccacgctgctgcagccgttccttgca
ggcgaccggctggagagccagctcgcggcgatctgcgaaagcgcgttcgactttcccgcg
ccgctgttgccgctggccacgcccggtgaccaggtgctggagctgttccacggacccacc
gcggcgttcaaggatttcggtgcgcgctttctggcgcagtgcctgacccgcctgcgcggc
gccgatgccaggccgctgacgatcctggtggcgacctccggcgataccggcgcggcggtg
gcggcggccttccaccggcagccgaacctgcgcgtggtggtgctgtatccggacggccgg
gtgtcgccgcgccaggcgcaccagctgggctgcttcggcgacaacatcaccgcgctgcgc
gtggccggctcgttcgatgactgccaggcgctggtcaagcgcgcgctgtccgatgcgtca
ctgcaggcgcgggcgccgctgagttcggccaacagcatcagcctgggccgcctgctgccg
cagatgagctattacgcgcacgccgcgctgtgccatcgcgcgcagaccggcaacacgctg
aacttcgtcattcccaccggcaacctgggcaatgcgatggccgccatcctggcgcgcgcg
ctgggcgtgccgatcggccggatcgtgctggccaccaacgccaaccgggtgctgccggat
tacttcgccggcaaggactacgcaccgcagcccagcgtggccacgatcgccaatgccatg
gacgtgggcgcgccgagcaacttcgagcgcctgcgctggctctaccacggcgatgatgcg
gcgctgcgtgcggccttcaccgcggccagcgtcgaggacgatgcgatcggcctgctgatc
gcgcgccgccatcgccactttggcgaggtgttctgcccgcacacggccaccgcagtcaag
gtcctggaagacctgcgcaaccagggcgtggagggcgactgggcggtggcggccaccgcc
cacccggccaagttcgaaggcgtggtcgagccgctggtgggcgcggtacccgtgccgccg
gcgctgaacgcgctgctgcagcgcccggcgcatgccgatccgatcgagccggactaccag
gccctggtccagcacatcctggccacgccggccggctga

DBGET integrated database retrieval system