KEGG   Pseudoxanthomonas spadix: DSC_06860Help
Entry
DSC_06860         CDS       T01643                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1275402..1275893
Genome map
AA seq 163 aa AA seqDB search
MAVTACIGLGANLGDAAGTVRAALSAIGALPGTTLVSASPLYLTLAWGMQAQPDFINAAA
RVDTTLDAPALLAALLEIERQFGRQRSGEQRWGPRTLDLDLLLYGDAMIELPGLQVPHPR
LHERAFALVPLADVAPELRIAGHGTVREAALRVGHDAIRVISG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcacggcctgcatcggcctgggggcgaacctgggcgatgcggccggcacggtg
cgcgccgcattgtccgcgatcggcgcgctgcccggcaccacgctggtgtcggcttcgccg
ctgtacctcaccctggcctggggcatgcaggcgcagccggatttcatcaacgccgccgcg
cgcgtggacaccacgctggacgcgccggcgctgctggccgcgctgttggagatcgagcgc
cagttcggccgccagcgcagcggcgagcagcgctggggcccgcgcacgctggacctggac
ctgttgctctacggcgatgcgatgatcgaactgcctggcctgcaggtgccgcatccgcgc
ctgcatgagcgcgcctttgcgctggtgccgctggccgatgtggcgccggaactgcgcatc
gccggccacgggacggtgcgggaagctgcattgcgcgtgggccatgacgccatccgggtg
atcagtggataa

DBGET integrated database retrieval system