KEGG   Pseudoxanthomonas spadix: DSC_07775Help
Entry
DSC_07775         CDS       T01643                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:psd00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:psd00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1486121..1486603
Genome map
AA seq 160 aa AA seqDB search
MRGVFEFSAIDINGHEQPLSDWAGSVLLIVNVASRCSFTPQYGGLEVLWQQYRDRGLVVL
GFPCDQFGHQEPGDQDQIRAFCSLNYAVSFPMFAKVEVNGERAHPLWQRLKRERPGLLGT
QRIKWNFTKFLVGRNGQVLRRYGPRRAPASLAADIGRALG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcgtcttcgagttttctgcgattgatatcaacgggcacgagcagccattgtcc
gactgggccggttcggtcctgttgatcgtcaacgtcgcctcgcgctgcagcttcaccccg
cagtacggcgggctggaagtgctgtggcagcagtaccgcgatcgcggactggtggtgctg
ggatttccgtgtgaccagttcggccaccaggagcccggtgaccaggaccagatccgcgcg
ttctgcagcctcaactacgcggtcagcttcccgatgttcgccaaggtggaggtcaacggc
gagcgcgcccatccgctgtggcagcgactcaagcgcgagcggcccggcctgctgggcacg
cagcggatcaagtggaacttcaccaagttcctggtcggccgcaacggccaggtgctcagg
cgttacggaccgcggcgcgcgccggcctcgctggcggctgacatcgggcgcgcgctgggt
tga

DBGET integrated database retrieval system