KEGG   Pseudoxanthomonas spadix: DSC_07775Help
Entry
DSC_07775         CDS       T01643                                 

Definition
(GenBank) glutathione peroxidase-like protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00480  Glutathione metabolism
psd00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    DSC_07775
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DSC_07775
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DSC_07775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AER56206
UniProt: G7UTV3
Position
1486121..1486603
Genome map
AA seq 160 aa AA seqDB search
MRGVFEFSAIDINGHEQPLSDWAGSVLLIVNVASRCSFTPQYGGLEVLWQQYRDRGLVVL
GFPCDQFGHQEPGDQDQIRAFCSLNYAVSFPMFAKVEVNGERAHPLWQRLKRERPGLLGT
QRIKWNFTKFLVGRNGQVLRRYGPRRAPASLAADIGRALG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcgtcttcgagttttctgcgattgatatcaacgggcacgagcagccattgtcc
gactgggccggttcggtcctgttgatcgtcaacgtcgcctcgcgctgcagcttcaccccg
cagtacggcgggctggaagtgctgtggcagcagtaccgcgatcgcggactggtggtgctg
ggatttccgtgtgaccagttcggccaccaggagcccggtgaccaggaccagatccgcgcg
ttctgcagcctcaactacgcggtcagcttcccgatgttcgccaaggtggaggtcaacggc
gagcgcgcccatccgctgtggcagcgactcaagcgcgagcggcccggcctgctgggcacg
cagcggatcaagtggaacttcaccaagttcctggtcggccgcaacggccaggtgctcagg
cgttacggaccgcggcgcgcgccggcctcgctggcggctgacatcgggcgcgcgctgggt
tga

DBGET integrated database retrieval system