KEGG   Pseudoxanthomonas spadix: DSC_07950Help
Entry
DSC_07950         CDS       T01643                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00020  Citrate cycle (TCA cycle)
psd00310  Lysine degradation
psd01100  Metabolic pathways
psd01110  Biosynthesis of secondary metabolites
psd01120  Microbial metabolism in diverse environments
psd01130  Biosynthesis of antibiotics
psd01200  Carbon metabolism
Module
psd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DSC_07950
  Amino acid metabolism
   00310 Lysine degradation
    DSC_07950
Enzymes [BR:psd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DSC_07950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H SAPS
Motif
Other DBs
NCBI-ProteinID: AER56241
UniProt: G7UUF0
Position
complement(1538147..1539373)
Genome map
AA seq 408 aa AA seqDB search
MATEVKVPALPESVSDATIASWHKKAGDAVRRDENLVDLETDKVVLEVPSPVDGVLKEIR
FQEGDTVTSSQVLAVIEEGAAAEAAPAKPAEEEVKPAAKEEKKEAPKAAEAPKAAKAEAP
KAAGDTASLPPGARFSALTEGVDPAQVEGTGRRGAVTKEDIVNFARSGGVGRAAGARPEE
RVPMTRVRKTIARRLMESKNSTAMLTTFNEVNLSKVSAARKELQDEFQKAHGIKLGFMSF
FVKAAANALQRFPLVNASIDGEDIIYHGYSDISIAVSTDKGLVTPVLRNVERQSFAEVEQ
GIADYAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHAIKERPIA
ENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaagtcaaagttccggcacttcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaaggccggtgatgcggtcaggcgcgacgagaacctggtggacctggag
accgacaaggtcgtcctggaagtgccctcgcccgtcgatggcgtgctcaaggagatcagg
ttccaggaaggcgacacggtcacctcctcgcaggtcctggccgtgatcgaggaaggcgcc
gccgccgaggccgccccggccaagccggccgaggaggaggtcaagcctgccgccaaggaa
gagaagaaggaagctcccaaggctgccgaggcaccgaaggccgccaaggccgaagcaccc
aaggccgccggcgacaccgcctcgctgccgccgggcgcgcggttttccgcactcaccgaa
ggcgtggatccggcccaggtggaaggcaccggccggcgcggcgcggtgaccaaggaagac
atcgtcaacttcgcccggtctggcggggtgggcagggccgcaggcgcccgtccggaagag
cgcgtgccgatgacccgggtgcgcaagaccatcgccaggcgtctgatggagtcgaagaac
tcgaccgccatgctgaccaccttcaacgaggtcaacctgagcaaggtttcggccgcgcgc
aaggagctgcaggacgagttccagaaggcccatggcatcaagctgggtttcatgagcttc
ttcgtcaaggccgcggccaacgcgctgcagcgcttccccctggtcaacgcctcgatcgac
ggcgaggacatcatctaccacggctacagcgacatctcgatcgccgtgtccaccgacaag
ggcctggtcacgccggtcctgcgcaacgtcgagcgccagtccttcgccgaggtcgagcag
ggcatcgccgactacgcggccaaggcccgggccggcaagctgggcctggacgacctgcag
ggtggcaccttcaccatcaccaacggcggcaccttcggctcgctgctgtccaccccgatc
atcaacccgccgcagagcgccatcctgggcatgcacgccatcaaggaacgcccgatcgcc
gagaacggccaggtcgtgatcgcgccgatgatgtacctggcgctgtcctacgaccaccgc
atcatcgatggcaaggattcggtgcagttcctggtggacatcaagaaccagctggaaaac
ccgggccggatgctgttcggcctgtag

DBGET integrated database retrieval system