KEGG   Pseudoxanthomonas spadix: DSC_08100Help
Entry
DSC_08100         CDS       T01643                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:psd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1569486..1570676
Genome map
AA seq 396 aa AA seqDB search
MNDTASLVATPFTPQPIPSWRRAVLKVGSSLLAADGVGLSPRFALGLAQFVSAHVQAGRE
VVIVSSGAVAAGRAIVPRVADAGGAIAARQALAALGQAQLIALWQRLFERPVAQVLLTHD
DLRNRRRYLNARATLLELLRLGTLPVINENDTVSVDELKLGDNDNLAAIVAALVDADALF
IATDIDGLYTADPRSNPAARPLDEVQVLTPEVLAMAGGSGSSVGTGGMRTKLEAAAKAGA
AGVETYLFNGRNAEVVRGLAQDRLSGTRIHAAQTRIAARKGWLRHAPVEPGAILIDAGAA
AALVEKGASLLPGGVTGAEGDFRRGDMVLVRTGDADGQRPLARGIAQYSAADIRRIARRH
SRDIEAVLGYSYGENVIHRDDLVLLGSAAPLPRTPR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaccgcttccctggttgccacgcctttcaccccgcagccgatcccgagctgg
cggcgggcggtgctcaaggtgggcagcagcctgctggccgccgatggcgtgggcctgtcg
ccgcgtttcgcgctggggttggcgcagttcgtctcggcgcacgtgcaggccgggcgcgaa
gtggtgatcgtgtcttccggcgcggtcgcggccgggcgggcgatcgtgcccagggtggcc
gacgcgggcggggcgatcgccgcgcgccaggcgctggccgcgctgggccaggcgcagctg
atcgcgctgtggcagcgccttttcgagcgtccggtcgcccaggtgctgctgacccacgac
gacctgcgcaatcgccgccgctacctcaatgcgcgcgccacgctgctggaattgctgcga
ttgggcaccctgccggtgatcaacgagaacgacaccgtctcggtggacgagctcaaactg
ggcgacaacgacaacctggcggcgatcgtcgccgcgctggtcgatgccgatgccctgttc
atcgccaccgacatcgatgggctgtacaccgccgatccgcgcagcaacccggccgcgcgc
ccgctggatgaagtgcaggtgctgacgccggaggtgttggccatggccggcggcagcggc
agcagtgtcggcaccggcggcatgcgcaccaagctggaggccgcggccaaggccggtgcg
gccggcgtggagacctacctgttcaacggccgcaatgccgaggtcgtgcgtggcctggcg
caggaccgactgagcggcacgcgcatccatgccgcgcagacccgcatcgccgcgcgcaag
ggctggctgcggcacgcgccggtcgaaccgggcgcgatcctgatcgatgccggcgccgcc
gcggcgctggtcgaaaagggcgcatcgctgctgcccggtggcgtgaccggcgccgaaggc
gatttccgccgcggcgacatggtgctggtgcgcaccggcgacgccgacggtcagcgcccg
ctggcgcgcggcatcgcccagtattcggcggccgacatccgccgcatcgcccgccgccac
tcgcgtgacatcgaggccgtgctgggctacagctatggtgagaacgtgatccaccgcgac
gacctggtgctgttgggcagcgccgctccacttccgaggactccacgatga

DBGET integrated database retrieval system