KEGG   Pseudoxanthomonas spadix: DSC_09585Help
Entry
DSC_09585         CDS       T01643                                 

Definition
succinate dehydrogenase membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
psd  Pseudoxanthomonas spadix
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DSC_09585
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DSC_09585
   00650 Butanoate metabolism
    DSC_09585
  Energy metabolism
   00190 Oxidative phosphorylation
    DSC_09585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1894553..1894945)
Genome map
AA seq 130 aa AA seqDB search
MSSTKRFRTPLKNARGLGSAKEGLQHWLLQRYTALALIVLGSWFVYFVISLVHADYLAAT
DAISRPWNAIALVAFLLAMFWHAQLGVQVVLEDYVHAPLTAMVSQLLVRFICLLGALASV
FAVVRIALGN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccaagcgtttccgcaccccactgaagaacgcccgcggcctgggctcggcc
aaggaaggcctgcagcactggctgctgcagcgctacacggccctggccctgatcgtgttg
gggagctggttcgtgtatttcgtcatcagcctggtccacgccgactacctggctgcgacc
gacgcgatctccaggccgtggaacgccatcgcgctggtggccttcctgctggccatgttc
tggcacgcgcaactgggcgtgcaggtggtcctggaggactacgtgcatgcgccgctgacg
gcgatggtgtcgcagctgctggtccgtttcatctgtctcctcggtgcgctggccagcgtc
ttcgccgtggtccgcatcgcactgggaaactga

DBGET integrated database retrieval system