KEGG   Pseudoxanthomonas spadix: DSC_09800Help
Entry
DSC_09800         CDS       T01643                                 

Definition
putative oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DSC_09800
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     DSC_09800
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     DSC_09800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1930484..1931041
Genome map
AA seq 185 aa AA seqDB search
MSRLRIFDHADPATPLLASNDPDLIAAELKKIGVLFERWQASKEVAPGATPEEVMEAYRA
DIDRLVNARGFKSVDVMSIAPDNPKRAELRTKFLDEHYHKEDEVRFFVAGSGLFTLHVDD
KVYEIECVRNDLIAVPDGTRHWFDMGPEPSFVAIRFFTEPDGWVGHFTGESIAARFPRYT
PGQPG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttcgcatcttcgaccacgccgacccggccacgccgctgctggccagcaac
gacccggacctgatcgccgccgaactgaagaaaatcggggtgctgttcgagcgctggcag
gcctccaaggaagtcgctcccggcgccacgcccgaggaagtgatggaggcctaccgcgcc
gacatcgaccgcctggtgaacgcgcgcggcttcaagtcggtggacgtgatgagcatcgcc
ccggacaaccccaagcgcgccgagctgcggaccaagttcctggacgagcactaccacaag
gaggacgaagtgcgcttcttcgtcgccggctcgggcctgttcaccctgcacgtggacgac
aaggtctacgagatcgagtgcgtgcgcaacgacctgatcgcggtgcccgacggcaccagg
cactggttcgacatggggcctgagcccagcttcgtggcgatccgcttcttcaccgagccc
gatggctgggtcgggcatttcaccggcgagagcattgccgcgcgcttcccgcgctacacc
ccgggccagccgggctga

DBGET integrated database retrieval system