KEGG   Pseudoxanthomonas spadix: DSC_09960Help
Entry
DSC_09960         CDS       T01643                                 

Definition
glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DSC_09960
Enzymes [BR:psd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DSC_09960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1957536..1959926)
Genome map
AA seq 796 aa AA seqDB search
MGDLDDLKKPQFALDAPGRPGIAPTWSSSAKDAVGCSLGLSRLWFTTGFGILNEVYYPRV
DLPQIRDLGFIVADGRGFWSEVKRLENYTVNFVAPGVAALEICHEHPRYTLRLRISPDPR
RDVLAIEVRLDGDAQLRPYVLLAPRLGATGHGNRATVGRHRGRCVLLAGQGPFALALAAV
DEDQRDAFSAASAGYVGHSDGWQDFARNGALTWRYPSAGPGNVALTGELPRRAVLALGFG
SSMSAAATLAISSLLQPFDMLLQHQVADWEAWQARRSERFAVPLDLPDSLRRQLQVSAMV
LRTHLDKTYPGAMVASLSVPWGDTGEERGGYHLVWPRDLVECAGALLALGAEEEARDTLR
YLIASQHEGGHWSQNQWLGGKPFWSGVQLDETAFPVLLAAAIDERGGLGGIEVGAMVGQA
LGFIALQGPVTQQDRWEENSGINSFTLATCIAALVAGSDFVAEDARQWVLALADYWNDRL
ESWAVARNTELADRLGVPAYHVRTAPAEVLQQGAAALRRPLPVRNREDGLILPADEHIST
DFLQLVRFGLRLADDPLILDSLAVVDHLLKVDTPAGPVWRRYNGDGYGEHDDGRAYDGTG
RGRPWPLLTGERGHYALAAGQDPLPWLETMAGLANATGLIPEQVWDGPDVPARRLVFGRP
TGAAMPLVWAHAEFTKLMVSRHLGAPFDRPRAVWARYKGQRPRIQRAFWSQMAPIGTLQP
GLGLVILLPAPALIHWGVDGWQDTQDLISVDSGLGFQVAELDVRPLRPGQRLDFTFRWQV
SSAWVGCDYHVRVETD
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatctggacgatttgaagaaaccgcagttcgcgttggatgctcccggccgtccc
ggcatcgcgccgacctggagcagcagtgcgaaagatgccgtgggctgttcgctcgggctt
tcgcggctgtggttcaccaccggcttcgggatcctcaacgaggtctattacccgcgtgtc
gaccttccccagatccgcgatctgggcttcatcgtggccgatggccgcggcttctggtcc
gaagtcaagcgactggaaaactacacagtgaacttcgtggcgccgggggttgcggcactg
gaaatctgtcatgaacatccgcgttacaccctgcggctgcggatctcccccgatccgcga
cgcgacgtgctggcgatcgaggttcggctggacggcgacgcgcagctgcggccctacgtg
ctgctcgccccccgcctgggggcaaccggccatggcaaccgcgccacggtcgggcgccat
cgtggccgctgcgtgctgctggccgggcaagggcctttcgcgctggccctcgccgccgtg
gatgaggaccagcgcgacgcgttcagcgcggccagcgccggttacgtcggtcacagcgac
ggctggcaggattttgcccgcaacggcgccttgacctggcgttatcccagcgccggtccg
ggcaatgtcgccctgaccggcgaactgccgcgccgggcagtgctggccctgggcttcgga
agcagcatgagcgcggcggcgaccctggccatctccagcctgctgcaaccgttcgacatg
ctcctgcaacatcaggtcgccgattgggaggcctggcaggcgcgccgcagtgagcgcttt
gcggtgccgctggatcttcccgattccctgcgccggcagttgcaggtctcggccatggtc
ctgcgcacccatctggacaagacctatccgggggcgatggtggccagcctcagcgttccc
tggggcgacacgggggaagagcggggcggttaccacctggtctggccgcgcgacctggtg
gaatgtgcaggcgcgctgctggccctgggcgccgaggaggaagcccgcgacaccctgcgc
tacctgatcgccagccagcacgagggcggccactggagccagaaccaatggctgggcggc
aaacccttctggtcgggggtccagctggacgaaacggccttcccggtgctgttggctgca
gcaatcgatgaacggggcggcctgggtggaatcgaagtgggcgccatggtcggccaggcg
ctgggcttcattgccctgcaggggccggtcacccagcaggatcgctgggaagaaaacagc
ggcatcaacagcttcacgcttgccacctgtatcgccgccctggtggcgggcagtgacttc
gtggccgaggacgcccgccaatgggtgctggcgctggccgactactggaatgatcgcctc
gaatcctgggccgtggcccgcaacaccgaactggcggaccgtctgggcgtgccggcctac
catgtgcgcaccgctcctgcggaagtgctgcagcagggagcggccgccctgcgccggccg
ctgccggtccgcaaccgcgaagatggtctgatcctgccggccgatgagcacatttccacc
gactttctccagctggtgcgctttggtctgcggcttgccgatgatcccttgatcctcgac
agcctggcggtggtggatcatctgctcaaggtcgacacgccggccggaccggtgtggcgg
cgctacaacggcgacggctatggcgaacacgacgatggccgcgcctacgacggcaccggt
cgcggacggccctggcccctgctgaccggcgagcgcgggcactatgcgctggccgcaggc
caggaccccttgccctggctggagaccatggcggggctggcaaatgccactggcctgatc
cccgagcaggtctgggatggcccggacgtgccggcgcggcgcctggtcttcgggcgtccg
accggggcggccatgcccctggtctgggcccatgcggagttcaccaagctgatggtgtcg
cgccatctgggcgctccgttcgaccggccccgagcggtctgggcgcgctacaagggacag
cgtccgcgcatccagcgcgcgttctggtcgcagatggcgcccatcggcaccctccagccc
gggcttgggctggtgatcctgctacctgcgccagccctgatccactggggcgtcgacggc
tggcaggacacccaggacctgatcagcgtcgacagcggcctgggttttcaggtggcggag
ctggacgtccggcccctgcggcccggccagcgcctggatttcacgttccgatggcaggtg
tccagcgcctgggtgggctgcgactatcatgtgagggtggaaaccgactga

DBGET integrated database retrieval system