KEGG   Pseudoxanthomonas spadix: DSC_10340Help
Entry
DSC_10340         CDS       T01643                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psd  Pseudoxanthomonas spadix
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DSC_10340
   00052 Galactose metabolism
    DSC_10340
   00500 Starch and sucrose metabolism
    DSC_10340
   00520 Amino sugar and nucleotide sugar metabolism
    DSC_10340
Enzymes [BR:psd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DSC_10340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2037319..2038221)
Genome map
AA seq 300 aa AA seqDB search
MTQRIHKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAVEAGCDTLIFVTNR
YKHAIGDYFDKAYELEDKLEAAGKLELLDKVRNPLPKGVRAIFVTQTEALGLGHAVLCAK
TIVGDEPFAVMLPDDLIVNRNGAGALKQMADAHASTGASQIAVQDVEPEQTASYGIVATD
AFDGRSGRINAIVEKPKPEDAPSNLGVVGRYVLDGSIFKLLEDTRPGAGGEIQLTDAIAA
LLKRKPVNAYRFKGTRFDCGAHIGLVEATIHYALHSEKIGEAAAEAMRNALKELGVRESE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcgtatccacaaggcagtgtttcccgttgccgggcttggcacgcgctttctg
ccggcaaccaagacggtgcccaaggaaatgctgcccatcattgacaggccattgatccag
tacgcggtcgatgaggccgtcgaagccggctgcgatacgctgatcttcgtgaccaaccgc
tacaagcatgcgatcggcgactacttcgacaaggcctacgagctggaagacaagctcgag
gccgcgggcaagctggagctgctggacaaggtccgcaatccgctgcccaagggcgtgcgt
gcgattttcgtgacccagaccgaagccctgggcctgggccatgcggtcctgtgcgccaag
accattgtcggcgacgagccatttgcggtgatgttgcctgacgatctgatcgtcaatcgc
aacggtgccggcgcgctcaagcagatggccgacgcccatgcatccaccggcgccagccag
atcgcggtgcaggatgtcgagcctgaacagaccgccagctacggcatcgtcgccaccgat
gcctttgacggtcgcagtggcaggatcaatgcgatagtcgaaaagcccaagccagaggac
gcgccgagcaaccttggcgtggtcggacgctacgtgctcgatggcagcatcttcaaactg
ctggaagacaccaggcccggtgccggcggcgagatccagctgaccgatgccatcgccgcg
ctgctcaagcgcaagcccgtgaatgcgtatcgcttcaagggcacgcgctttgactgcggg
gcgcacatcggcctggtcgaggccaccatccattacgcgctgcatagcgaaaagatcggc
gaagccgcggccgaagccatgcgcaatgcgctgaaggaactgggcgttcgcgagtccgaa
tga

DBGET integrated database retrieval system